Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1706
Gene name
LocationContig_149:34501..38473
Strand-
Gene length (bp)3972
Transcript length (bp)3972
Coding sequence length (bp)3972
Protein length (aa) 1324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 8.1E-15 881 968

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13683|YDY2_SCHPO Uncharacterized protein C11E3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.02c PE=3 SV=1 30 1293 6.0E-91
sp|Q08748|YO296_YEAST Uncharacterized protein YOR296W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR296W PE=1 SV=1 230 1287 7.0E-55
sp|Q9P7K5|GIT1_SCHPO Adenylate cyclase activation protein git1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git1 PE=1 SV=1 279 1191 3.0E-20
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 870 989 3.0E-11
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 840 991 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13683|YDY2_SCHPO Uncharacterized protein C11E3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.02c PE=3 SV=1 30 1293 6.0E-91
sp|Q08748|YO296_YEAST Uncharacterized protein YOR296W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR296W PE=1 SV=1 230 1287 7.0E-55
sp|Q9P7K5|GIT1_SCHPO Adenylate cyclase activation protein git1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git1 PE=1 SV=1 279 1191 3.0E-20
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 870 989 3.0E-11
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 840 991 2.0E-10
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 883 966 5.0E-09
sp|P24506|SY62_DIPOM Synaptotagmin-B OS=Diplobatis ommata GN=P65-B PE=1 SV=1 882 985 7.0E-09
sp|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=1 SV=2 882 985 3.0E-08
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 883 995 5.0E-08
sp|A0A075F932|SYT1_ANSCY Synaptotagmin-1 OS=Anser cygnoid GN=SYT1 PE=2 SV=1 884 985 6.0E-08
sp|P47191|SYT1_CHICK Synaptotagmin-1 OS=Gallus gallus GN=SYT1 PE=2 SV=1 884 985 7.0E-08
sp|Q54FM6|Y0753_DICDI C2 domain-containing protein DDB_G0290753 OS=Dictyostelium discoideum GN=DDB_G0290753 PE=3 SV=1 893 974 1.0E-07
sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus GN=SYT1 PE=1 SV=1 884 985 1.0E-07
sp|P24507|SY63_DIPOM Synaptotagmin-C OS=Diplobatis ommata GN=P65-C PE=2 SV=1 877 960 1.0E-07
sp|P21579|SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens GN=SYT1 PE=1 SV=1 884 985 1.0E-07
sp|P21707|SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus GN=Syt1 PE=1 SV=3 884 985 1.0E-07
sp|P46096|SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus GN=Syt1 PE=1 SV=1 884 985 1.0E-07
sp|Q60HC0|SYT1_MACFA Synaptotagmin-1 OS=Macaca fascicularis GN=SYT1 PE=2 SV=1 884 985 2.0E-07
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 884 985 2.0E-07
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 877 977 1.0E-06
sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 884 966 1.0E-06
sp|Q9Y6V0|PCLO_HUMAN Protein piccolo OS=Homo sapiens GN=PCLO PE=1 SV=4 884 986 3.0E-06
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 871 1001 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1706
MSTSWRGVKKLSGDSGKARAPSWTRPTHGAVDHEEARSMALRTAYLHYLVQPRAKRKHYVAAPRQAAARSHTSIG
QLLQEYVSGSSSSLKLPHSFAGQLLDSIAGVCRGVETLPGYKDAAVKRSFAEAYTAFSEKSFRRSMDMERKLEPL
VLIFYSAATKAAQKGRVCDDDSWKTLPDRHLALFVRLSAKVLRASGHDRDRPELMSRLTSLENKLLTNDQNLVHE
GGEGAGSTVEVRVPLSYDVKDMPMVQTVAAIFGQSLSDVQGEIRAKVKVWTEEAALRDLKTYQHRLNSDQEGALR
SHDFQNMEAFNEWKKSEAPHLSHMMLDILTAKPELAKTPTGARSRPQSLYSEEAGWGVSDGAGSLDAALSSLGVE
ASSGAEAMYTFIPAEARAVYKYIVQLAMTFDQLHARPEKGMSTQPLSKQSMELMTQLCVCWRIPQSSRLVAFVEV
AAAKFLDGEMVATELDAMFDLVKGGLPEPKKAPAMSQHSTALLELDPMQWPIYDANAYVKTLRSLHERLLRELHE
LMGHCYDSKPPDMAAVRYLLEKHVGSDPAFVADAAAQDDFCEHLEQTLREKAADVYRECMEREIPARRQDWQFGH
VVRLGKAIARLCESIRKRFRKTPVVMGVSPLQVLVAEALPSLEKDAGAMVEMIMSDGEVELEDAFDLYGELVQIR
RLHRDVLPQVPFAFNVEELLMGFVWRFIGAAEQRMGGLVDAAIEQDAFEVGGEGMERHSVSVMDLFMLLNQTVDQ
VVALEWDNGAHHASFMTALARIVAAGTGRYCDVVEQRFAREMDRPAAAHESAAARTRHDSWVQLAREALGSRDKA
EPFHFYAQSLVKLNNMEYAMQQLDKLDRRMDSEACAQVLQQLPAAPSKTRRPATYTFTIKVVEAEDVKACDPSGY
SDPYVVFGDEYQKRLHKTRIAYRTLNPRWDESFDMTVQGAVNVIATIWDHDTFGDHDYVGRTSLKLDPAHFGDYL
PREFWLDLDSQGRLLVRVSMEGERDDMQFHFGKAFRHVKRTQRDMVRSITDKLTAHIKATLSLDTLRSLLGMGGI
GASVSSLWKKRASTPAQVDDALTPLLAYFDDNFAMMKQTLTDATMMAVMARLWKEVLMTIEKLLLPPLSDKPSLQ
RPLSRRQVDIVYHWLDMLFAFFNARDHDSGEQLGVPAELLKSPKWHDLASVNFFYFEDTPSLIRESERMASTAAH
HAHQTLQNRMSPAASSGPSLPAPGAFATMGTVGTIRRGKSIMMTRNLGTMRLAKEAKRREAQAEASDDMILRILR
MRPEAAHYLKERHRQKERQAATAAAALIVRNSVMQGWNATKNNALPRC*
Coding >OphauB2|1706
ATGTCGACGTCGTGGCGGGGTGTCAAGAAGCTGAGCGGCGACTCGGGCAAGGCGCGGGCTCCGTCGTGGACGCGG
CCGACGCATGGCGCGGTGGACCACGAGGAGGCTCGCAGCATGGCGCTGCGGACGGCCTACCTGCACTACCTGGTG
CAGCCGCGGGCCAAGAGAAAGCACTATGTGGCGGCGCCCCGGCAGGCTGCGGCGCGGTCGCACACGAGCATCGGG
CAGCTGCTTCAGGAGTACGTCTCTGGAAGCTCGTCGAGCCTCAAGCTGCCGCACAGCTTCGCCGGGCAACTGCTG
GATAGCATCGCGGGCGTGTGCCGGGGCGTGGAGACGCTTCCCGGGTACAAGGACGCGGCGGTGAAGCGCAGCTTT
GCCGAAGCCTACACGGCCTTTTCGGAAAAGTCGTTTCGGCGGTCCATGGACATGGAGCGCAAGCTGGAGCCCCTG
GTGCTGATATTCTACTCGGCGGCGACAAAGGCGGCGCAAAAGGGCCGCGTGTGCGACGACGACTCATGGAAGACG
CTGCCGGACCGGCACCTTGCCCTCTTTGTACGGCTGTCGGCCAAGGTGCTGCGCGCCAGCGGGCACGACCGCGAC
CGCCCCGAGCTCATGTCGCGACTGACGTCGCTGGAGAACAAGCTCTTGACAAACGACCAGAACCTGGTGCATGAG
GGCGGCGAGGGCGCGGGCAGCACGGTGGAGGTGCGGGTGCCCTTGAGCTATGATGTCAAGGACATGCCCATGGTG
CAGACTGTGGCGGCGATTTTTGGCCAAAGCCTGTCCGACGTGCAGGGCGAGATCAGGGCCAAGGTCAAGGTGTGG
ACAGAAGAGGCAGCGCTGCGCGATCTCAAGACATACCAGCACCGGCTCAACTCGGACCAGGAGGGGGCGCTCCGA
AGCCACGACTTCCAAAACATGGAGGCCTTTAACGAGTGGAAAAAGTCGGAGGCGCCTCACCTGTCGCACATGATG
CTCGACATCCTGACGGCCAAGCCCGAGCTGGCCAAGACGCCGACGGGGGCGCGCAGCAGGCCGCAGTCGCTTTAC
AGTGAGGAGGCGGGGTGGGGCGTCTCGGACGGGGCGGGCAGCCTGGATGCGGCTCTCAGCTCGCTGGGGGTGGAG
GCCAGCAGCGGCGCAGAGGCCATGTACACCTTTATCCCGGCTGAGGCGCGAGCAGTCTACAAGTACATTGTGCAG
CTGGCCATGACGTTTGACCAGCTGCACGCGCGGCCGGAAAAGGGCATGTCGACGCAGCCGCTGTCGAAGCAGTCG
ATGGAGCTCATGACGCAGCTGTGTGTGTGCTGGCGGATTCCGCAGTCGTCGCGCCTGGTGGCGTTTGTGGAGGTG
GCGGCGGCCAAGTTTTTGGACGGGGAAATGGTGGCGACGGAGCTGGATGCCATGTTCGACCTGGTCAAGGGGGGC
CTGCCCGAGCCCAAGAAGGCGCCGGCCATGTCGCAGCACTCGACGGCGCTGCTGGAGCTGGATCCGATGCAGTGG
CCCATTTACGACGCCAACGCCTATGTCAAGACGCTGCGCAGCCTGCACGAGAGGCTGCTGCGCGAGCTCCACGAG
CTCATGGGCCACTGCTACGACAGCAAGCCGCCCGACATGGCGGCGGTGCGCTATCTGCTGGAGAAGCACGTGGGC
AGCGACCCGGCCTTTGTGGCGGATGCGGCGGCGCAGGACGACTTTTGCGAGCACCTGGAGCAGACGCTGAGGGAA
AAGGCGGCCGACGTGTACCGCGAATGCATGGAGCGGGAGATTCCGGCGCGGCGGCAAGACTGGCAGTTTGGGCAC
GTGGTGCGGCTGGGCAAGGCCATTGCCAGGCTGTGCGAGAGCATCCGCAAGCGCTTCCGCAAGACGCCCGTGGTG
ATGGGGGTGAGCCCGCTGCAGGTGCTGGTGGCGGAGGCGCTGCCGAGCCTGGAGAAGGACGCGGGGGCCATGGTT
GAAATGATTATGAGCGACGGCGAGGTGGAGCTGGAGGATGCCTTTGACCTCTACGGCGAGCTGGTGCAGATTCGG
CGCCTGCACCGCGACGTGCTGCCGCAGGTGCCCTTTGCCTTTAATGTGGAGGAGCTGCTCATGGGCTTTGTGTGG
CGCTTCATTGGCGCGGCGGAGCAGCGCATGGGCGGCCTCGTCGACGCGGCCATTGAGCAGGACGCCTTTGAGGTG
GGCGGCGAGGGGATGGAGCGGCACAGCGTGTCCGTCATGGACCTGTTTATGCTCTTGAACCAGACGGTGGACCAG
GTGGTGGCGCTCGAGTGGGACAATGGAGCGCACCACGCCAGCTTCATGACGGCGCTGGCGCGCATCGTGGCGGCG
GGCACTGGCCGCTACTGCGACGTGGTGGAGCAGCGGTTTGCGCGCGAGATGGACCGGCCGGCGGCGGCGCACGAG
AGCGCAGCGGCTCGCACGCGGCACGACTCGTGGGTGCAGCTGGCGCGCGAGGCTCTGGGCAGCAGGGACAAGGCC
GAGCCCTTTCACTTTTACGCGCAGTCGCTCGTCAAGCTCAACAACATGGAGTATGCCATGCAGCAGCTGGACAAG
CTGGACAGGCGCATGGACTCGGAGGCGTGCGCCCAGGTGCTCCAGCAGCTGCCGGCCGCGCCCTCCAAGACGCGG
CGGCCGGCCACCTACACCTTTACCATCAAGGTGGTCGAGGCCGAGGACGTCAAGGCCTGCGACCCCAGCGGCTAC
AGCGACCCCTACGTCGTCTTTGGCGACGAGTACCAGAAGCGCCTGCACAAGACGCGCATCGCCTACCGCACCCTC
AACCCGCGCTGGGACGAGTCGTTTGACATGACGGTGCAGGGCGCCGTCAACGTGATTGCCACCATCTGGGACCAC
GACACCTTTGGCGACCACGACTACGTCGGCCGCACCTCGCTCAAGCTCGATCCCGCCCACTTTGGCGACTACCTG
CCCCGCGAGTTTTGGCTCGATCTCGACTCCCAGGGCCGCCTGCTCGTTAGGGTCAGCATGGAGGGCGAGCGCGAC
GACATGCAGTTCCACTTTGGCAAGGCCTTTCGCCATGTCAAGCGCACCCAGCGCGACATGGTGCGCTCCATTACC
GACAAGCTGACGGCCCACATCAAGGCCACTCTCTCCCTCGACACCCTGCGCTCCCTGCTGGGCATGGGCGGCATT
GGCGCCTCCGTCTCCAGCCTGTGGAAGAAGCGCGCCTCCACCCCCGCCCAGGTCGACGACGCCCTGACGCCCCTC
CTCGCCTACTTTGACGACAACTTTGCCATGATGAAGCAGACCCTGACCGACGCCACCATGATGGCCGTCATGGCC
CGCCTGTGGAAGGAGGTGCTCATGACGATTGAGAAGCTGCTCCTCCCGCCCCTCTCGGACAAGCCCTCGCTCCAG
CGGCCCCTGAGCCGCCGCCAAGTCGACATTGTCTACCACTGGCTCGACATGCTCTTTGCCTTTTTCAATGCCCGC
GACCACGACTCGGGCGAGCAGCTGGGCGTGCCCGCCGAGCTGCTCAAGTCGCCCAAGTGGCACGACCTGGCCTCG
GTCAACTTCTTCTACTTTGAGGACACCCCCAGCCTCATCCGTGAGTCGGAGCGCATGGCCTCGACCGCTGCCCAC
CACGCCCACCAGACGCTACAGAACCGCATGTCGCCTGCCGCCTCGTCTGGCCCCAGCCTGCCCGCCCCCGGCGCC
TTTGCCACCATGGGCACCGTGGGCACCATTCGCCGCGGCAAGAGCATCATGATGACGCGCAATCTCGGCACCATG
CGCCTGGCCAAGGAGGCCAAGCGCCGCGAGGCCCAGGCCGAGGCCAGCGACGACATGATTCTGCGCATCCTCCGC
ATGCGGCCCGAGGCCGCCCACTATCTCAAGGAGAGGCACCGCCAAAAGGAGCGCCAGGCTGCCACTGCTGCTGCC
GCTCTCATTGTTAGGAACAGTGTCATGCAGGGCTGGAACGCCACCAAGAACAATGCCCTGCCTCGCTGCTAA
Transcript >OphauB2|1706
ATGTCGACGTCGTGGCGGGGTGTCAAGAAGCTGAGCGGCGACTCGGGCAAGGCGCGGGCTCCGTCGTGGACGCGG
CCGACGCATGGCGCGGTGGACCACGAGGAGGCTCGCAGCATGGCGCTGCGGACGGCCTACCTGCACTACCTGGTG
CAGCCGCGGGCCAAGAGAAAGCACTATGTGGCGGCGCCCCGGCAGGCTGCGGCGCGGTCGCACACGAGCATCGGG
CAGCTGCTTCAGGAGTACGTCTCTGGAAGCTCGTCGAGCCTCAAGCTGCCGCACAGCTTCGCCGGGCAACTGCTG
GATAGCATCGCGGGCGTGTGCCGGGGCGTGGAGACGCTTCCCGGGTACAAGGACGCGGCGGTGAAGCGCAGCTTT
GCCGAAGCCTACACGGCCTTTTCGGAAAAGTCGTTTCGGCGGTCCATGGACATGGAGCGCAAGCTGGAGCCCCTG
GTGCTGATATTCTACTCGGCGGCGACAAAGGCGGCGCAAAAGGGCCGCGTGTGCGACGACGACTCATGGAAGACG
CTGCCGGACCGGCACCTTGCCCTCTTTGTACGGCTGTCGGCCAAGGTGCTGCGCGCCAGCGGGCACGACCGCGAC
CGCCCCGAGCTCATGTCGCGACTGACGTCGCTGGAGAACAAGCTCTTGACAAACGACCAGAACCTGGTGCATGAG
GGCGGCGAGGGCGCGGGCAGCACGGTGGAGGTGCGGGTGCCCTTGAGCTATGATGTCAAGGACATGCCCATGGTG
CAGACTGTGGCGGCGATTTTTGGCCAAAGCCTGTCCGACGTGCAGGGCGAGATCAGGGCCAAGGTCAAGGTGTGG
ACAGAAGAGGCAGCGCTGCGCGATCTCAAGACATACCAGCACCGGCTCAACTCGGACCAGGAGGGGGCGCTCCGA
AGCCACGACTTCCAAAACATGGAGGCCTTTAACGAGTGGAAAAAGTCGGAGGCGCCTCACCTGTCGCACATGATG
CTCGACATCCTGACGGCCAAGCCCGAGCTGGCCAAGACGCCGACGGGGGCGCGCAGCAGGCCGCAGTCGCTTTAC
AGTGAGGAGGCGGGGTGGGGCGTCTCGGACGGGGCGGGCAGCCTGGATGCGGCTCTCAGCTCGCTGGGGGTGGAG
GCCAGCAGCGGCGCAGAGGCCATGTACACCTTTATCCCGGCTGAGGCGCGAGCAGTCTACAAGTACATTGTGCAG
CTGGCCATGACGTTTGACCAGCTGCACGCGCGGCCGGAAAAGGGCATGTCGACGCAGCCGCTGTCGAAGCAGTCG
ATGGAGCTCATGACGCAGCTGTGTGTGTGCTGGCGGATTCCGCAGTCGTCGCGCCTGGTGGCGTTTGTGGAGGTG
GCGGCGGCCAAGTTTTTGGACGGGGAAATGGTGGCGACGGAGCTGGATGCCATGTTCGACCTGGTCAAGGGGGGC
CTGCCCGAGCCCAAGAAGGCGCCGGCCATGTCGCAGCACTCGACGGCGCTGCTGGAGCTGGATCCGATGCAGTGG
CCCATTTACGACGCCAACGCCTATGTCAAGACGCTGCGCAGCCTGCACGAGAGGCTGCTGCGCGAGCTCCACGAG
CTCATGGGCCACTGCTACGACAGCAAGCCGCCCGACATGGCGGCGGTGCGCTATCTGCTGGAGAAGCACGTGGGC
AGCGACCCGGCCTTTGTGGCGGATGCGGCGGCGCAGGACGACTTTTGCGAGCACCTGGAGCAGACGCTGAGGGAA
AAGGCGGCCGACGTGTACCGCGAATGCATGGAGCGGGAGATTCCGGCGCGGCGGCAAGACTGGCAGTTTGGGCAC
GTGGTGCGGCTGGGCAAGGCCATTGCCAGGCTGTGCGAGAGCATCCGCAAGCGCTTCCGCAAGACGCCCGTGGTG
ATGGGGGTGAGCCCGCTGCAGGTGCTGGTGGCGGAGGCGCTGCCGAGCCTGGAGAAGGACGCGGGGGCCATGGTT
GAAATGATTATGAGCGACGGCGAGGTGGAGCTGGAGGATGCCTTTGACCTCTACGGCGAGCTGGTGCAGATTCGG
CGCCTGCACCGCGACGTGCTGCCGCAGGTGCCCTTTGCCTTTAATGTGGAGGAGCTGCTCATGGGCTTTGTGTGG
CGCTTCATTGGCGCGGCGGAGCAGCGCATGGGCGGCCTCGTCGACGCGGCCATTGAGCAGGACGCCTTTGAGGTG
GGCGGCGAGGGGATGGAGCGGCACAGCGTGTCCGTCATGGACCTGTTTATGCTCTTGAACCAGACGGTGGACCAG
GTGGTGGCGCTCGAGTGGGACAATGGAGCGCACCACGCCAGCTTCATGACGGCGCTGGCGCGCATCGTGGCGGCG
GGCACTGGCCGCTACTGCGACGTGGTGGAGCAGCGGTTTGCGCGCGAGATGGACCGGCCGGCGGCGGCGCACGAG
AGCGCAGCGGCTCGCACGCGGCACGACTCGTGGGTGCAGCTGGCGCGCGAGGCTCTGGGCAGCAGGGACAAGGCC
GAGCCCTTTCACTTTTACGCGCAGTCGCTCGTCAAGCTCAACAACATGGAGTATGCCATGCAGCAGCTGGACAAG
CTGGACAGGCGCATGGACTCGGAGGCGTGCGCCCAGGTGCTCCAGCAGCTGCCGGCCGCGCCCTCCAAGACGCGG
CGGCCGGCCACCTACACCTTTACCATCAAGGTGGTCGAGGCCGAGGACGTCAAGGCCTGCGACCCCAGCGGCTAC
AGCGACCCCTACGTCGTCTTTGGCGACGAGTACCAGAAGCGCCTGCACAAGACGCGCATCGCCTACCGCACCCTC
AACCCGCGCTGGGACGAGTCGTTTGACATGACGGTGCAGGGCGCCGTCAACGTGATTGCCACCATCTGGGACCAC
GACACCTTTGGCGACCACGACTACGTCGGCCGCACCTCGCTCAAGCTCGATCCCGCCCACTTTGGCGACTACCTG
CCCCGCGAGTTTTGGCTCGATCTCGACTCCCAGGGCCGCCTGCTCGTTAGGGTCAGCATGGAGGGCGAGCGCGAC
GACATGCAGTTCCACTTTGGCAAGGCCTTTCGCCATGTCAAGCGCACCCAGCGCGACATGGTGCGCTCCATTACC
GACAAGCTGACGGCCCACATCAAGGCCACTCTCTCCCTCGACACCCTGCGCTCCCTGCTGGGCATGGGCGGCATT
GGCGCCTCCGTCTCCAGCCTGTGGAAGAAGCGCGCCTCCACCCCCGCCCAGGTCGACGACGCCCTGACGCCCCTC
CTCGCCTACTTTGACGACAACTTTGCCATGATGAAGCAGACCCTGACCGACGCCACCATGATGGCCGTCATGGCC
CGCCTGTGGAAGGAGGTGCTCATGACGATTGAGAAGCTGCTCCTCCCGCCCCTCTCGGACAAGCCCTCGCTCCAG
CGGCCCCTGAGCCGCCGCCAAGTCGACATTGTCTACCACTGGCTCGACATGCTCTTTGCCTTTTTCAATGCCCGC
GACCACGACTCGGGCGAGCAGCTGGGCGTGCCCGCCGAGCTGCTCAAGTCGCCCAAGTGGCACGACCTGGCCTCG
GTCAACTTCTTCTACTTTGAGGACACCCCCAGCCTCATCCGTGAGTCGGAGCGCATGGCCTCGACCGCTGCCCAC
CACGCCCACCAGACGCTACAGAACCGCATGTCGCCTGCCGCCTCGTCTGGCCCCAGCCTGCCCGCCCCCGGCGCC
TTTGCCACCATGGGCACCGTGGGCACCATTCGCCGCGGCAAGAGCATCATGATGACGCGCAATCTCGGCACCATG
CGCCTGGCCAAGGAGGCCAAGCGCCGCGAGGCCCAGGCCGAGGCCAGCGACGACATGATTCTGCGCATCCTCCGC
ATGCGGCCCGAGGCCGCCCACTATCTCAAGGAGAGGCACCGCCAAAAGGAGCGCCAGGCTGCCACTGCTGCTGCC
GCTCTCATTGTTAGGAACAGTGTCATGCAGGGCTGGAACGCCACCAAGAACAATGCCCTGCCTCGCTGCTAA
Gene >OphauB2|1706
ATGTCGACGTCGTGGCGGGGTGTCAAGAAGCTGAGCGGCGACTCGGGCAAGGCGCGGGCTCCGTCGTGGACGCGG
CCGACGCATGGCGCGGTGGACCACGAGGAGGCTCGCAGCATGGCGCTGCGGACGGCCTACCTGCACTACCTGGTG
CAGCCGCGGGCCAAGAGAAAGCACTATGTGGCGGCGCCCCGGCAGGCTGCGGCGCGGTCGCACACGAGCATCGGG
CAGCTGCTTCAGGAGTACGTCTCTGGAAGCTCGTCGAGCCTCAAGCTGCCGCACAGCTTCGCCGGGCAACTGCTG
GATAGCATCGCGGGCGTGTGCCGGGGCGTGGAGACGCTTCCCGGGTACAAGGACGCGGCGGTGAAGCGCAGCTTT
GCCGAAGCCTACACGGCCTTTTCGGAAAAGTCGTTTCGGCGGTCCATGGACATGGAGCGCAAGCTGGAGCCCCTG
GTGCTGATATTCTACTCGGCGGCGACAAAGGCGGCGCAAAAGGGCCGCGTGTGCGACGACGACTCATGGAAGACG
CTGCCGGACCGGCACCTTGCCCTCTTTGTACGGCTGTCGGCCAAGGTGCTGCGCGCCAGCGGGCACGACCGCGAC
CGCCCCGAGCTCATGTCGCGACTGACGTCGCTGGAGAACAAGCTCTTGACAAACGACCAGAACCTGGTGCATGAG
GGCGGCGAGGGCGCGGGCAGCACGGTGGAGGTGCGGGTGCCCTTGAGCTATGATGTCAAGGACATGCCCATGGTG
CAGACTGTGGCGGCGATTTTTGGCCAAAGCCTGTCCGACGTGCAGGGCGAGATCAGGGCCAAGGTCAAGGTGTGG
ACAGAAGAGGCAGCGCTGCGCGATCTCAAGACATACCAGCACCGGCTCAACTCGGACCAGGAGGGGGCGCTCCGA
AGCCACGACTTCCAAAACATGGAGGCCTTTAACGAGTGGAAAAAGTCGGAGGCGCCTCACCTGTCGCACATGATG
CTCGACATCCTGACGGCCAAGCCCGAGCTGGCCAAGACGCCGACGGGGGCGCGCAGCAGGCCGCAGTCGCTTTAC
AGTGAGGAGGCGGGGTGGGGCGTCTCGGACGGGGCGGGCAGCCTGGATGCGGCTCTCAGCTCGCTGGGGGTGGAG
GCCAGCAGCGGCGCAGAGGCCATGTACACCTTTATCCCGGCTGAGGCGCGAGCAGTCTACAAGTACATTGTGCAG
CTGGCCATGACGTTTGACCAGCTGCACGCGCGGCCGGAAAAGGGCATGTCGACGCAGCCGCTGTCGAAGCAGTCG
ATGGAGCTCATGACGCAGCTGTGTGTGTGCTGGCGGATTCCGCAGTCGTCGCGCCTGGTGGCGTTTGTGGAGGTG
GCGGCGGCCAAGTTTTTGGACGGGGAAATGGTGGCGACGGAGCTGGATGCCATGTTCGACCTGGTCAAGGGGGGC
CTGCCCGAGCCCAAGAAGGCGCCGGCCATGTCGCAGCACTCGACGGCGCTGCTGGAGCTGGATCCGATGCAGTGG
CCCATTTACGACGCCAACGCCTATGTCAAGACGCTGCGCAGCCTGCACGAGAGGCTGCTGCGCGAGCTCCACGAG
CTCATGGGCCACTGCTACGACAGCAAGCCGCCCGACATGGCGGCGGTGCGCTATCTGCTGGAGAAGCACGTGGGC
AGCGACCCGGCCTTTGTGGCGGATGCGGCGGCGCAGGACGACTTTTGCGAGCACCTGGAGCAGACGCTGAGGGAA
AAGGCGGCCGACGTGTACCGCGAATGCATGGAGCGGGAGATTCCGGCGCGGCGGCAAGACTGGCAGTTTGGGCAC
GTGGTGCGGCTGGGCAAGGCCATTGCCAGGCTGTGCGAGAGCATCCGCAAGCGCTTCCGCAAGACGCCCGTGGTG
ATGGGGGTGAGCCCGCTGCAGGTGCTGGTGGCGGAGGCGCTGCCGAGCCTGGAGAAGGACGCGGGGGCCATGGTT
GAAATGATTATGAGCGACGGCGAGGTGGAGCTGGAGGATGCCTTTGACCTCTACGGCGAGCTGGTGCAGATTCGG
CGCCTGCACCGCGACGTGCTGCCGCAGGTGCCCTTTGCCTTTAATGTGGAGGAGCTGCTCATGGGCTTTGTGTGG
CGCTTCATTGGCGCGGCGGAGCAGCGCATGGGCGGCCTCGTCGACGCGGCCATTGAGCAGGACGCCTTTGAGGTG
GGCGGCGAGGGGATGGAGCGGCACAGCGTGTCCGTCATGGACCTGTTTATGCTCTTGAACCAGACGGTGGACCAG
GTGGTGGCGCTCGAGTGGGACAATGGAGCGCACCACGCCAGCTTCATGACGGCGCTGGCGCGCATCGTGGCGGCG
GGCACTGGCCGCTACTGCGACGTGGTGGAGCAGCGGTTTGCGCGCGAGATGGACCGGCCGGCGGCGGCGCACGAG
AGCGCAGCGGCTCGCACGCGGCACGACTCGTGGGTGCAGCTGGCGCGCGAGGCTCTGGGCAGCAGGGACAAGGCC
GAGCCCTTTCACTTTTACGCGCAGTCGCTCGTCAAGCTCAACAACATGGAGTATGCCATGCAGCAGCTGGACAAG
CTGGACAGGCGCATGGACTCGGAGGCGTGCGCCCAGGTGCTCCAGCAGCTGCCGGCCGCGCCCTCCAAGACGCGG
CGGCCGGCCACCTACACCTTTACCATCAAGGTGGTCGAGGCCGAGGACGTCAAGGCCTGCGACCCCAGCGGCTAC
AGCGACCCCTACGTCGTCTTTGGCGACGAGTACCAGAAGCGCCTGCACAAGACGCGCATCGCCTACCGCACCCTC
AACCCGCGCTGGGACGAGTCGTTTGACATGACGGTGCAGGGCGCCGTCAACGTGATTGCCACCATCTGGGACCAC
GACACCTTTGGCGACCACGACTACGTCGGCCGCACCTCGCTCAAGCTCGATCCCGCCCACTTTGGCGACTACCTG
CCCCGCGAGTTTTGGCTCGATCTCGACTCCCAGGGCCGCCTGCTCGTTAGGGTCAGCATGGAGGGCGAGCGCGAC
GACATGCAGTTCCACTTTGGCAAGGCCTTTCGCCATGTCAAGCGCACCCAGCGCGACATGGTGCGCTCCATTACC
GACAAGCTGACGGCCCACATCAAGGCCACTCTCTCCCTCGACACCCTGCGCTCCCTGCTGGGCATGGGCGGCATT
GGCGCCTCCGTCTCCAGCCTGTGGAAGAAGCGCGCCTCCACCCCCGCCCAGGTCGACGACGCCCTGACGCCCCTC
CTCGCCTACTTTGACGACAACTTTGCCATGATGAAGCAGACCCTGACCGACGCCACCATGATGGCCGTCATGGCC
CGCCTGTGGAAGGAGGTGCTCATGACGATTGAGAAGCTGCTCCTCCCGCCCCTCTCGGACAAGCCCTCGCTCCAG
CGGCCCCTGAGCCGCCGCCAAGTCGACATTGTCTACCACTGGCTCGACATGCTCTTTGCCTTTTTCAATGCCCGC
GACCACGACTCGGGCGAGCAGCTGGGCGTGCCCGCCGAGCTGCTCAAGTCGCCCAAGTGGCACGACCTGGCCTCG
GTCAACTTCTTCTACTTTGAGGACACCCCCAGCCTCATCCGTGAGTCGGAGCGCATGGCCTCGACCGCTGCCCAC
CACGCCCACCAGACGCTACAGAACCGCATGTCGCCTGCCGCCTCGTCTGGCCCCAGCCTGCCCGCCCCCGGCGCC
TTTGCCACCATGGGCACCGTGGGCACCATTCGCCGCGGCAAGAGCATCATGATGACGCGCAATCTCGGCACCATG
CGCCTGGCCAAGGAGGCCAAGCGCCGCGAGGCCCAGGCCGAGGCCAGCGACGACATGATTCTGCGCATCCTCCGC
ATGCGGCCCGAGGCCGCCCACTATCTCAAGGAGAGGCACCGCCAAAAGGAGCGCCAGGCTGCCACTGCTGCTGCC
GCTCTCATTGTTAGGAACAGTGTCATGCAGGGCTGGAACGCCACCAAGAACAATGCCCTGCCTCGCTGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail