Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1702
Gene name
LocationContig_149:13487..16059
Strand+
Gene length (bp)2572
Transcript length (bp)2394
Coding sequence length (bp)2394
Protein length (aa) 798

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05786 Cnd2 Condensin complex subunit 2 1.8E-265 21 787

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7R3|CND2_SCHPO Condensin complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnd2 PE=1 SV=1 28 786 2.0E-110
sp|P38170|CND2_YEAST Condensin complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRN1 PE=1 SV=3 91 796 4.0E-81
sp|Q564K3|CND2_ARATH Condensin complex subunit 2 OS=Arabidopsis thaliana GN=CAPH PE=1 SV=1 109 298 4.0E-32
sp|O13067|CND2_XENLA Condensin complex subunit 2 OS=Xenopus laevis GN=ncaph PE=1 SV=1 102 274 2.0E-15
sp|Q564K3|CND2_ARATH Condensin complex subunit 2 OS=Arabidopsis thaliana GN=CAPH PE=1 SV=1 503 785 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7R3|CND2_SCHPO Condensin complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnd2 PE=1 SV=1 28 786 2.0E-110
sp|P38170|CND2_YEAST Condensin complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRN1 PE=1 SV=3 91 796 4.0E-81
sp|Q564K3|CND2_ARATH Condensin complex subunit 2 OS=Arabidopsis thaliana GN=CAPH PE=1 SV=1 109 298 4.0E-32
sp|O13067|CND2_XENLA Condensin complex subunit 2 OS=Xenopus laevis GN=ncaph PE=1 SV=1 102 274 2.0E-15
sp|Q564K3|CND2_ARATH Condensin complex subunit 2 OS=Arabidopsis thaliana GN=CAPH PE=1 SV=1 503 785 2.0E-13
sp|Q15003|CND2_HUMAN Condensin complex subunit 2 OS=Homo sapiens GN=NCAPH PE=1 SV=3 25 286 3.0E-13
sp|Q8C156|CND2_MOUSE Condensin complex subunit 2 OS=Mus musculus GN=Ncaph PE=1 SV=1 27 286 5.0E-13
sp|O13067|CND2_XENLA Condensin complex subunit 2 OS=Xenopus laevis GN=ncaph PE=1 SV=1 493 788 1.0E-12
sp|Q8C156|CND2_MOUSE Condensin complex subunit 2 OS=Mus musculus GN=Ncaph PE=1 SV=1 493 785 3.0E-12
sp|Q15003|CND2_HUMAN Condensin complex subunit 2 OS=Homo sapiens GN=NCAPH PE=1 SV=3 458 787 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0007076 mitotic chromosome condensation Yes
GO:0000796 condensin complex Yes
GO:0051276 chromosome organization No
GO:0032991 protein-containing complex No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0022402 cell cycle process No
GO:0008150 biological_process No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No
GO:0005575 cellular_component No
GO:0030261 chromosome condensation No
GO:0044815 DNA packaging complex No
GO:1903047 mitotic cell cycle process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4333
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3548
Ophiocordyceps australis map64 (Brazil) OphauB2|1702 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07147
Ophiocordyceps camponoti-rufipedis Ophun1|6041
Ophiocordyceps kimflemingae Ophio5|2709
Ophiocordyceps subramaniannii Hirsu2|890

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1702
MPRVAQVPRAASARSVTGAQATASPAKSPVKIPLNDDAQERGQRMTCRKALHDKQIKQIRAAATPRKTAAQDGSE
SEACLAASATPRGGLDDDDDGLGASVTPMKRVPILANFEEWMKMATDNKINATNSWNFALIDYFHDMSLLKEGDG
VNFQKASCTLDGCVKIYTNRVDSVATETGKLLSGLADSNSSKNKGRHGDAESDQEGDEELDQEGNVKKKSKNKHS
RGSEATLAPSFSALQLKRFELEFTVDPLFKKASADFDEGGAKGLLLNHLMIDSQGRIVFDSSDDCADVAAPGKQD
GHAAGDEAEHDDHAGEADEADEPQAEPQAESQAEPQTQAQARQVEGNSSQTQHGMAPRIDLRCLGRKFFAHLAQL
DELDVCPSLKHFDLGDPLGSLKIPLLKAADDADRSGLFIDEDDAAKFDNQDDHGLGLGSFDMEDNETAFGQGGEA
WARETAVVGTHERQEQEIEAQGEYVVAMAQATRRDSLHQDMLGFFDQALHKNWTSAQHWRIRKIKEGNKAPAEAR
RRRDKEAFEIDFGAPLQAQQADMVLTPAASASAICLPKKDWTCKSRNLVPDDKHFASSSLISLFLKPKARLTRRR
HCLSHAPDAMDEAFWAKRQHSPPDDDAAPPPGDYDANFFHDDGLPFAASHDNDHGDLPPDPDAQAAVSQTLFPLA
QPAAMGAFGSTLVTQTRRIRPDYVQYARKAKKVDVRRLKQELWKGMDFAGPASLDKSLRFTDVMDSLQAVYPKPV
MDDISTSYCFISLLHLANEEGLVIEHTPDLTELHIKRDSTALVDPAH*
Coding >OphauB2|1702
ATGCCTCGTGTTGCTCAGGTTCCCCGTGCCGCCAGCGCGAGGTCAGTCACTGGCGCGCAGGCCACGGCATCGCCC
GCCAAGTCGCCCGTCAAGATTCCGCTCAACGACGACGCGCAAGAACGCGGGCAGAGAATGACGTGTCGCAAGGCG
CTCCACGACAAGCAAATCAAGCAGATTCGCGCGGCCGCCACGCCCCGCAAGACAGCGGCACAAGATGGTTCGGAA
AGCGAAGCATGCCTTGCTGCGTCGGCGACGCCCCGCGGTGGTCTTGACGACGACGACGACGGCCTTGGCGCCTCA
GTGACGCCCATGAAGCGCGTGCCCATTCTGGCAAACTTTGAGGAGTGGATGAAGATGGCGACGGACAACAAGATC
AATGCCACCAACTCGTGGAACTTTGCCCTCATTGACTACTTTCACGACATGTCGCTGCTCAAGGAGGGCGATGGC
GTCAACTTTCAAAAGGCCAGCTGCACCCTGGACGGATGTGTCAAGATATACACAAACCGCGTCGACAGCGTTGCC
ACGGAAACGGGCAAGCTCCTGAGCGGGCTTGCCGACAGCAACTCGAGCAAGAACAAGGGGCGCCACGGCGACGCC
GAGAGCGACCAAGAGGGTGACGAGGAGCTTGACCAAGAGGGCAACGTCAAGAAGAAGTCCAAGAACAAGCACTCG
CGAGGGTCCGAGGCGACGCTGGCACCGTCGTTTAGCGCACTGCAGCTAAAGAGATTTGAGCTCGAGTTCACCGTC
GACCCGCTCTTCAAGAAGGCATCGGCCGACTTTGACGAAGGCGGTGCCAAGGGACTGCTGCTCAACCACCTCATG
ATTGACTCGCAGGGGCGCATTGTGTTTGACAGTAGCGACGATTGCGCCGACGTGGCGGCGCCTGGCAAGCAAGAC
GGGCACGCGGCTGGCGACGAGGCTGAGCATGACGACCATGCCGGCGAGGCTGACGAGGCTGACGAGCCCCAGGCC
GAGCCCCAGGCCGAGTCCCAGGCCGAGCCCCAGACCCAGGCCCAGGCCCGGCAGGTCGAGGGCAACAGCAGCCAG
ACGCAGCATGGCATGGCGCCTCGCATTGACCTGAGGTGCTTGGGCCGCAAATTCTTTGCCCACCTGGCCCAGCTT
GACGAGCTCGACGTGTGTCCCTCACTCAAGCACTTTGACCTGGGAGACCCCCTCGGCTCCCTCAAGATTCCCTTG
CTCAAGGCAGCCGACGACGCAGACAGGTCGGGCCTCTTTATCGACGAGGACGACGCGGCCAAGTTTGACAACCAA
GACGACCATGGGCTCGGCCTGGGCAGCTTCGACATGGAGGACAACGAGACGGCCTTTGGCCAGGGCGGCGAGGCC
TGGGCGCGGGAGACGGCCGTTGTCGGCACGCACGAGAGGCAGGAGCAAGAGATTGAGGCGCAGGGCGAATACGTG
GTGGCCATGGCGCAAGCCACGAGGCGCGACTCGCTGCACCAAGACATGCTGGGCTTCTTTGACCAGGCCTTGCAC
AAGAACTGGACGAGCGCGCAGCACTGGCGCATCCGCAAAATCAAGGAGGGCAACAAGGCTCCGGCCGAGGCGAGG
AGGCGCCGGGACAAGGAGGCTTTTGAAATCGACTTTGGCGCGCCGCTGCAGGCCCAGCAGGCCGACATGGTGCTG
ACGCCGGCAGCCTCGGCCTCGGCCATCTGCCTGCCCAAGAAGGACTGGACTTGCAAGTCGCGCAACCTGGTGCCC
GACGACAAGCACTTTGCCTCGTCCTCCCTCATCAGCCTCTTTCTCAAGCCCAAGGCCCGCCTCACGCGCCGTCGC
CACTGCCTCTCGCATGCCCCCGACGCCATGGACGAGGCCTTTTGGGCCAAGCGCCAGCACTCGCCCCCCGACGAC
GACGCTGCGCCCCCGCCCGGCGACTACGACGCAAACTTCTTCCACGACGACGGCCTGCCCTTTGCCGCCTCGCAC
GACAATGACCACGGCGACTTGCCCCCCGACCCAGACGCCCAAGCAGCCGTCAGCCAGACCCTCTTTCCCCTCGCC
CAGCCCGCCGCCATGGGCGCCTTTGGCTCAACCCTCGTGACGCAGACGCGCCGCATCAGACCCGACTATGTCCAG
TACGCCCGCAAGGCCAAAAAGGTGGATGTGCGCCGCCTCAAGCAAGAATTATGGAAGGGCATGGACTTTGCCGGC
CCTGCCAGCCTCGACAAGAGCCTCAGGTTTACAGACGTCATGGACTCTCTCCAGGCCGTCTACCCCAAGCCCGTC
ATGGACGACATTTCAACCTCGTACTGCTTCATTTCCTTGCTGCATCTCGCCAATGAAGAGGGCCTTGTCATTGAG
CACACCCCCGACCTGACCGAGCTGCACATCAAAAGGGACTCGACGGCACTTGTTGACCCCGCCCACTAG
Transcript >OphauB2|1702
ATGCCTCGTGTTGCTCAGGTTCCCCGTGCCGCCAGCGCGAGGTCAGTCACTGGCGCGCAGGCCACGGCATCGCCC
GCCAAGTCGCCCGTCAAGATTCCGCTCAACGACGACGCGCAAGAACGCGGGCAGAGAATGACGTGTCGCAAGGCG
CTCCACGACAAGCAAATCAAGCAGATTCGCGCGGCCGCCACGCCCCGCAAGACAGCGGCACAAGATGGTTCGGAA
AGCGAAGCATGCCTTGCTGCGTCGGCGACGCCCCGCGGTGGTCTTGACGACGACGACGACGGCCTTGGCGCCTCA
GTGACGCCCATGAAGCGCGTGCCCATTCTGGCAAACTTTGAGGAGTGGATGAAGATGGCGACGGACAACAAGATC
AATGCCACCAACTCGTGGAACTTTGCCCTCATTGACTACTTTCACGACATGTCGCTGCTCAAGGAGGGCGATGGC
GTCAACTTTCAAAAGGCCAGCTGCACCCTGGACGGATGTGTCAAGATATACACAAACCGCGTCGACAGCGTTGCC
ACGGAAACGGGCAAGCTCCTGAGCGGGCTTGCCGACAGCAACTCGAGCAAGAACAAGGGGCGCCACGGCGACGCC
GAGAGCGACCAAGAGGGTGACGAGGAGCTTGACCAAGAGGGCAACGTCAAGAAGAAGTCCAAGAACAAGCACTCG
CGAGGGTCCGAGGCGACGCTGGCACCGTCGTTTAGCGCACTGCAGCTAAAGAGATTTGAGCTCGAGTTCACCGTC
GACCCGCTCTTCAAGAAGGCATCGGCCGACTTTGACGAAGGCGGTGCCAAGGGACTGCTGCTCAACCACCTCATG
ATTGACTCGCAGGGGCGCATTGTGTTTGACAGTAGCGACGATTGCGCCGACGTGGCGGCGCCTGGCAAGCAAGAC
GGGCACGCGGCTGGCGACGAGGCTGAGCATGACGACCATGCCGGCGAGGCTGACGAGGCTGACGAGCCCCAGGCC
GAGCCCCAGGCCGAGTCCCAGGCCGAGCCCCAGACCCAGGCCCAGGCCCGGCAGGTCGAGGGCAACAGCAGCCAG
ACGCAGCATGGCATGGCGCCTCGCATTGACCTGAGGTGCTTGGGCCGCAAATTCTTTGCCCACCTGGCCCAGCTT
GACGAGCTCGACGTGTGTCCCTCACTCAAGCACTTTGACCTGGGAGACCCCCTCGGCTCCCTCAAGATTCCCTTG
CTCAAGGCAGCCGACGACGCAGACAGGTCGGGCCTCTTTATCGACGAGGACGACGCGGCCAAGTTTGACAACCAA
GACGACCATGGGCTCGGCCTGGGCAGCTTCGACATGGAGGACAACGAGACGGCCTTTGGCCAGGGCGGCGAGGCC
TGGGCGCGGGAGACGGCCGTTGTCGGCACGCACGAGAGGCAGGAGCAAGAGATTGAGGCGCAGGGCGAATACGTG
GTGGCCATGGCGCAAGCCACGAGGCGCGACTCGCTGCACCAAGACATGCTGGGCTTCTTTGACCAGGCCTTGCAC
AAGAACTGGACGAGCGCGCAGCACTGGCGCATCCGCAAAATCAAGGAGGGCAACAAGGCTCCGGCCGAGGCGAGG
AGGCGCCGGGACAAGGAGGCTTTTGAAATCGACTTTGGCGCGCCGCTGCAGGCCCAGCAGGCCGACATGGTGCTG
ACGCCGGCAGCCTCGGCCTCGGCCATCTGCCTGCCCAAGAAGGACTGGACTTGCAAGTCGCGCAACCTGGTGCCC
GACGACAAGCACTTTGCCTCGTCCTCCCTCATCAGCCTCTTTCTCAAGCCCAAGGCCCGCCTCACGCGCCGTCGC
CACTGCCTCTCGCATGCCCCCGACGCCATGGACGAGGCCTTTTGGGCCAAGCGCCAGCACTCGCCCCCCGACGAC
GACGCTGCGCCCCCGCCCGGCGACTACGACGCAAACTTCTTCCACGACGACGGCCTGCCCTTTGCCGCCTCGCAC
GACAATGACCACGGCGACTTGCCCCCCGACCCAGACGCCCAAGCAGCCGTCAGCCAGACCCTCTTTCCCCTCGCC
CAGCCCGCCGCCATGGGCGCCTTTGGCTCAACCCTCGTGACGCAGACGCGCCGCATCAGACCCGACTATGTCCAG
TACGCCCGCAAGGCCAAAAAGGTGGATGTGCGCCGCCTCAAGCAAGAATTATGGAAGGGCATGGACTTTGCCGGC
CCTGCCAGCCTCGACAAGAGCCTCAGGTTTACAGACGTCATGGACTCTCTCCAGGCCGTCTACCCCAAGCCCGTC
ATGGACGACATTTCAACCTCGTACTGCTTCATTTCCTTGCTGCATCTCGCCAATGAAGAGGGCCTTGTCATTGAG
CACACCCCCGACCTGACCGAGCTGCACATCAAAAGGGACTCGACGGCACTTGTTGACCCCGCCCACTAG
Gene >OphauB2|1702
ATGCCTCGTGTTGCTCAGGTTCCCCGTGCCGCCAGCGCGAGGTCAGTCACTGGCGCGCAGGCCACGGCATCGCCC
GCCAAGTCGCCCGTCAAGTGAGTCTTGTCCCTCGTTCTCTTCTCCTAGTCGTGTTTTGGCATCATGTGGGTGGCT
CACGCAGCAAGATGCAGGATTCCGCTCAACGACGACGCGCAAGAACGCGGGCAGAGAATGACGTGTCGCAAGGCG
CTCCACGACAAGCAAATCAAGCAGATTCGCGCGGCCGCCACGCCCCGCAAGACAGCGGCACAAGATGGTTCGGAA
AGCGAAGCATGCCTTGCTGCGTCGGCGACGCCCCGCGGTGGTCTTGACGACGACGACGACGGCCTTGGCGCCTCA
GTGACGCCCATGAAGCGCGTGCCCATTCTGGCAAACTTTGAGGAGTGGATGAAGATGGCGACGGACAACAAGATC
AATGCCACCAACTCGTGGAACTTTGCCCTCATTGACTACTTTCACGACATGTCGCTGCTCAAGGAGGGCGATGGC
GTCAACTTTCAAAAGGCCAGCTGCACCCTGGACGGATGTGTCAAGATATACACAAACCGCGTCGACAGCGTTGCC
ACGGAAACGGGCAAGCTCCTGAGCGGGCTTGCCGACAGCAACTCGAGCAAGAACAAGGGGCGCCACGGCGACGCC
GAGAGCGACCAAGAGGGTGACGAGGAGCTTGACCAAGAGGGCAACGTCAAGAAGAAGTCCAAGAACAAGGTAGGC
AGGCCCAGAGCACTTGCAGCGGCAGGCTACTGACGCGAGGCAGCACTCGCGAGGGTCCGAGGCGACGCTGGCACC
GTCGTTTAGCGCACTGCAGCTAAAGAGATTTGAGCTCGAGTTCACCGTCGACCCGCTCTTCAAGAAGGCATCGGC
CGACTTTGACGAAGGCGGTGCCAAGGGACTGCTGCTCAACCACCTCATGATTGACTCGCAGGGGCGCATTGTGTT
TGACAGTAGCGACGATTGCGCCGACGTGGCGGCGCCTGGCAAGCAAGACGGGCACGCGGCTGGCGACGAGGCTGA
GCATGACGACCATGCCGGCGAGGCTGACGAGGCTGACGAGCCCCAGGCCGAGCCCCAGGCCGAGTCCCAGGCCGA
GCCCCAGACCCAGGCCCAGGCCCGGCAGGTCGAGGGCAACAGCAGCCAGACGCAGCATGGCATGGCGCCTCGCAT
TGACCTGAGGTGCTTGGGCCGCAAATTCTTTGCCCACCTGGCCCAGCTTGACGAGCTCGACGTGTGTCCCTCACT
CAAGCACTTTGACCTGGGAGACCCCCTCGGCTCCCTCAAGATTCCCTTGCTCAAGGCAGCCGACGACGCAGACAG
GTCGGGCCTCTTTATCGACGAGGACGACGCGGCCAAGTTTGACAACCAAGACGACCATGGGCTCGGCCTGGGCAG
CTTCGACATGGAGGACAACGAGACGGCCTTTGGCCAGGGCGGCGAGGCCTGGGCGCGGGAGACGGCCGTTGTCGG
CACGCACGAGAGGCAGGAGCAAGAGATTGAGGCGCAGGGCGAATACGTGGTGGCCATGGCGCAAGCCACGAGGCG
CGACTCGCTGCACCAAGACATGCTGGGCTTCTTTGACCAGGCCTTGCACAAGAACTGGACGAGCGCGCAGCACTG
GCGCATCCGCAAAATCAAGGAGGGCAACAAGGCTCCGGCCGAGGCGAGGAGGCGCCGGGACAAGGAGGCTTTTGA
AATCGACTTTGGCGCGCCGCTGCAGGCCCAGCAGGCCGACATGGTGCTGACGCCGGCAGCCTCGGCCTCGGCCAT
CTGCCTGCCCAAGAAGGACTGGACTTGCAAGTCGCGCAACCTGGTGCCCGACGACAAGCACTTTGCCTCGTCCTC
CCTCATCAGCCTCTTTCTCAAGCCCAAGGCCCGCCTCACGCGCCGTCGCCACTGCCTCTCGCATGCCCCCGACGC
CATGGACGAGGCCTTTTGGGCCAAGCGCCAGCACTCGCCCCCCGACGACGACGCTGCGCCCCCGCCCGGCGACTA
CGACGCAAACTTCTTCCACGACGACGGCCTGCCCTTTGCCGCCTCGCACGACAATGACCACGGCGACTTGCCCCC
CGACCCAGACGCCCAAGCAGCCGTCAGCCAGACCCTCTTTCCCCTCGCCCAGCCCGCCGCCATGGGCGCCTTTGG
CTCAACCCTCGTGACGCAGACGCGCCGCATCAGACCCGACTATGTCCAGTACGCCCGCAAGGCCAAAAAGGTGGA
TGTGCGCCGCCTCAAGCAAGAATTATGGAAGGGCATGGACTTTGCCGTGAGCACCCCGTCTCCCTGCTGCCCCTC
GCCGCTGACTTGCCTTCTCCCACAGGGCCCTGCCAGCCTCGACAAGAGCCTCAGGTTTACAGACGTCATGGACTC
TCTCCAGGCCGTCTACCCCAAGCCCGTCATGGACGACATTTCAACCTCGTACTGCTTCATTTCCTTGCTGCATCT
CGCCAATGAAGAGGGCCTTGTCATTGAGCACACCCCCGACCTGACCGAGCTGCACATCAAAAGGGACTCGACGGC
ACTTGTTGACCCCGCCCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail