Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1701
Gene name
LocationContig_149:9339..12784
Strand-
Gene length (bp)3445
Transcript length (bp)3378
Coding sequence length (bp)3378
Protein length (aa) 1126

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05277 DUF726 Protein of unknown function (DUF726) 4.1E-126 551 887

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43564|YFD4_YEAST Uncharacterized membrane protein YFL034W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL034W PE=1 SV=2 223 961 0.0E+00
sp|O14244|YELD_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.13c PE=3 SV=1 185 917 0.0E+00
sp|Q5TGY1|TMCO4_HUMAN Transmembrane and coiled-coil domain-containing protein 4 OS=Homo sapiens GN=TMCO4 PE=2 SV=1 481 886 9.0E-51
sp|Q499U8|TMCO4_RAT Transmembrane and coiled-coil domain-containing protein 4 OS=Rattus norvegicus GN=Tmco4 PE=2 SV=1 481 886 1.0E-50
sp|Q20035|TMCO4_CAEEL Uncharacterized membrane protein F35D11.3 OS=Caenorhabditis elegans GN=F35D11.3 PE=3 SV=2 478 886 6.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43564|YFD4_YEAST Uncharacterized membrane protein YFL034W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL034W PE=1 SV=2 223 961 0.0E+00
sp|O14244|YELD_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.13c PE=3 SV=1 185 917 0.0E+00
sp|Q5TGY1|TMCO4_HUMAN Transmembrane and coiled-coil domain-containing protein 4 OS=Homo sapiens GN=TMCO4 PE=2 SV=1 481 886 9.0E-51
sp|Q499U8|TMCO4_RAT Transmembrane and coiled-coil domain-containing protein 4 OS=Rattus norvegicus GN=Tmco4 PE=2 SV=1 481 886 1.0E-50
sp|Q20035|TMCO4_CAEEL Uncharacterized membrane protein F35D11.3 OS=Caenorhabditis elegans GN=F35D11.3 PE=3 SV=2 478 886 6.0E-49
sp|Q91WU4|TMCO4_MOUSE Transmembrane and coiled-coil domain-containing protein 4 OS=Mus musculus GN=Tmco4 PE=2 SV=2 481 886 1.0E-48
sp|Q9US10|YK68_SCHPO Uncharacterized membrane protein C6F6.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.08c PE=3 SV=1 492 882 8.0E-42
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 554 576 22
2 583 605 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1701
MATDSGPDAHAAPETIANAAEPESDEFGLPIRRFVTPMQKPADADCSASCTQQSAIDAPDKLNQPKSHQASCTPA
LEGQAAVASQVDSDSDDAPFEDAQPAFTSAEHHEQSSSHASPLKAQGDAAATPKPTSADSEPPALPTPAASTKDA
QLSADRDAETASSTREANVDKTPRPPETSEPVTAHSRDTSATSNSITGLGISEFSHQRLSMQHDKLDPEDDLGWQ
TMPSYARYDMYDDDDRLIAREHNVDEDEADGYSGLGGAGKGYTRVIMDEDAQSATSMDENTQYLFKEANGTSAMG
EDEGRDAVAQMQATKDLLTEGQRIAYVGVVRLEIFNMVKEAEAIESTKKTKKDLATSAEAIKMWGQKMMIRLYAH
MDISEAEQVMIEQLAEHGVRPADLTPALHANSRVHNPMAEEKEPSGKGQQEASSPLSTGVVDEQAAEPLPPYEGL
GSSEVPQVQTPSQMPTTEKIDIDLRWTILCDLFLLLIADSIYDARSRVLLERVGASIEITWIDICRFEKRITDAL
EMQQAAEKENWNEDEHMESRRKMAQKRRYVMMGLATVGGGLVIGLSAGLLAPVIGAGLAAGFTTIGVTGTSSFLA
GAGGAAIITSSAAASGSIIGVRAANRRTGAVKTFEYRPLHNNKRVNLIVTVSGWLTGKVDDVRLPFSTVDPIMGD
IYSVLWEPEMLRSMGDTINILATEALTQGLQQILGSTILISLMAALQLPIVLTKLSYLIDNPWAVSLDRATAAGL
ILADSLLERSLGTRPITLVGYSLGARVIFSCMQELAKKGAYGLIQNVYMFGSPIVVRKEEYLRARTIVSGRFVNG
YNRNDWILGYLFRLTNGGIRRVAGLAAIEDCPWMENIDVSELVAGHMEYRKAMPTLLMKCGWMVESDEFTEIEDP
DPDNHQERQRELINEIEEARKELERGAKTKKASKFALFGRRKKAERQEWEVYEDSAGKENKASSGDEGTNTGVLF
DIDAIRAELAKEAAHRGEVAQEELQVREIKSTLPPMKLDMASSSSSTLPLACKEEVNTLRETRSAEAVSSSLRHA
SAGWGADDKNDEYGGEGEEEIDMVFDTSFEPRHGEEAGKPSMWAAQTVPNVTLADPWADEDEDFGKEQEISMTFA
*
Coding >OphauB2|1701
ATGGCCACAGACTCCGGCCCCGACGCCCACGCAGCGCCAGAGACCATTGCAAACGCTGCTGAGCCAGAGTCTGAC
GAGTTTGGCCTGCCAATTCGGCGCTTTGTCACACCGATGCAAAAGCCGGCAGACGCCGACTGCAGCGCATCATGC
ACACAGCAGAGTGCCATTGACGCCCCAGACAAGCTGAATCAGCCCAAGTCCCATCAAGCTTCTTGCACACCGGCT
TTGGAAGGACAGGCTGCAGTAGCTAGCCAAGTCGACAGTGATAGCGACGACGCCCCCTTTGAGGATGCTCAACCA
GCATTCACATCCGCTGAGCATCATGAGCAGTCGTCCAGTCATGCTTCGCCCTTAAAGGCGCAAGGAGACGCTGCT
GCAACGCCCAAGCCGACATCTGCAGATTCCGAACCCCCAGCTCTCCCGACACCAGCCGCTTCTACCAAGGACGCC
CAGCTTTCGGCGGACCGAGATGCAGAGACAGCCTCAAGTACCCGCGAAGCCAATGTCGACAAGACACCACGGCCT
CCCGAAACCTCGGAGCCCGTAACAGCACATAGTCGAGATACCAGCGCAACTTCAAACTCCATAACTGGCCTCGGC
ATCTCCGAGTTTTCCCATCAACGGCTCTCGATGCAGCATGACAAGTTGGATCCAGAAGATGACCTCGGCTGGCAG
ACAATGCCATCGTATGCTCGGTATGACATGTACGATGATGATGACCGCCTTATTGCTCGAGAGCACAATGTGGAT
GAAGACGAGGCAGACGGCTATAGTGGCCTCGGAGGAGCTGGAAAAGGATATACGCGAGTCATCATGGACGAGGAC
GCTCAATCGGCTACAAGCATGGACGAGAATACCCAATACCTGTTCAAAGAAGCTAATGGCACAAGTGCAATGGGT
GAAGATGAAGGTCGCGATGCCGTTGCACAGATGCAAGCGACCAAGGACCTATTAACAGAGGGCCAGAGGATAGCA
TACGTCGGTGTCGTTCGCCTTGAAATATTCAACATGGTAAAGGAGGCTGAAGCAATCGAGTCGACCAAAAAGACA
AAAAAGGACCTGGCAACTTCAGCCGAGGCCATCAAGATGTGGGGTCAAAAAATGATGATTCGCCTGTACGCCCAT
ATGGACATTAGCGAAGCCGAGCAGGTCATGATTGAGCAGCTGGCGGAACATGGGGTGAGGCCGGCAGACCTTACT
CCAGCCCTTCACGCAAACTCGAGGGTCCACAACCCCATGGCAGAAGAAAAGGAGCCTAGCGGCAAGGGCCAGCAA
GAGGCATCTTCTCCATTATCGACTGGTGTAGTGGACGAACAGGCAGCAGAGCCGCTGCCACCGTATGAAGGGTTG
GGCAGCTCAGAAGTGCCACAGGTACAAACACCATCACAAATGCCGACAACGGAAAAGATTGACATTGATCTTCGG
TGGACAATTCTTTGCGATTTATTTCTTCTTCTCATTGCCGACTCCATCTATGATGCGCGCTCAAGAGTGCTCCTA
GAGCGCGTTGGTGCGAGCATAGAAATTACGTGGATTGATATTTGCAGGTTTGAGAAGAGGATAACGGACGCGCTC
GAGATGCAACAGGCAGCAGAGAAAGAAAACTGGAACGAAGACGAGCACATGGAGAGCCGGCGCAAAATGGCCCAG
AAGCGGCGCTATGTCATGATGGGACTGGCGACGGTTGGCGGCGGTCTTGTCATTGGTCTTTCGGCTGGTCTTTTG
GCACCTGTGATTGGCGCTGGACTGGCTGCAGGCTTCACCACGATTGGGGTAACGGGCACGAGCAGCTTTCTGGCC
GGTGCGGGTGGCGCAGCCATCATCACATCGTCAGCAGCTGCTTCGGGTAGCATCATTGGCGTCAGGGCGGCTAAT
CGCCGGACCGGAGCGGTCAAGACGTTTGAATACCGTCCACTGCACAACAACAAGCGCGTCAATCTTATAGTGACG
GTGTCTGGATGGCTAACGGGCAAGGTGGACGATGTGCGGCTACCCTTTAGCACCGTTGACCCCATCATGGGGGAC
ATCTACTCGGTCTTGTGGGAGCCTGAGATGCTGCGCAGCATGGGCGACACCATCAACATCCTAGCTACCGAGGCT
CTCACTCAGGGACTGCAGCAGATTCTGGGCAGCACGATACTCATCAGCCTGATGGCGGCACTGCAGCTGCCTATT
GTCTTGACTAAACTATCGTATCTGATTGATAACCCATGGGCCGTCTCTCTTGACCGAGCAACGGCGGCAGGCCTC
ATCTTGGCCGACTCGCTGCTGGAGCGCAGCCTGGGCACACGACCCATTACACTTGTCGGGTACTCCTTGGGCGCC
AGAGTCATCTTTTCGTGCATGCAGGAGCTGGCTAAAAAGGGGGCATACGGGCTGATTCAAAACGTTTACATGTTT
GGCTCGCCGATAGTGGTGAGGAAGGAAGAATACCTCCGAGCCCGCACTATTGTTTCGGGACGTTTTGTCAATGGC
TATAACCGCAACGACTGGATCCTTGGCTACCTCTTTCGGCTGACGAATGGCGGGATACGGCGAGTGGCGGGGCTG
GCGGCAATTGAGGACTGTCCATGGATGGAGAACATTGACGTGTCAGAACTTGTCGCTGGACACATGGAGTATCGA
AAGGCTATGCCTACACTGCTTATGAAATGTGGATGGATGGTGGAAAGCGACGAATTCACAGAAATCGAGGATCCG
GATCCTGACAACCACCAGGAACGACAAAGAGAACTCATCAATGAGATCGAGGAGGCGCGAAAGGAGCTTGAGAGA
GGAGCCAAGACGAAAAAGGCGAGCAAGTTTGCCCTGTTTGGTCGACGCAAGAAGGCGGAGAGACAGGAATGGGAG
GTTTATGAGGACTCGGCCGGCAAGGAGAACAAGGCCAGCAGTGGAGATGAAGGTACGAATACGGGTGTTTTATTC
GACATTGATGCGATTCGGGCCGAGCTGGCCAAAGAAGCAGCGCATCGAGGAGAAGTGGCGCAAGAGGAGCTGCAG
GTTCGGGAAATCAAATCGACGCTACCGCCCATGAAGCTCGACATGGCATCATCGTCATCGTCGACGTTGCCACTG
GCGTGCAAGGAAGAGGTGAATACGCTGCGCGAGACCAGAAGCGCCGAGGCGGTGAGCAGTAGCTTGCGGCATGCG
AGCGCGGGCTGGGGCGCAGACGACAAGAATGACGAATATGGCGGCGAGGGAGAGGAGGAGATTGACATGGTGTTT
GACACGTCGTTTGAGCCACGACACGGCGAAGAGGCAGGAAAGCCAAGCATGTGGGCGGCTCAAACGGTGCCGAAT
GTTACACTGGCGGATCCGTGGGCAGACGAAGACGAAGACTTTGGAAAGGAGCAGGAGATATCAATGACGTTTGCA
TAA
Transcript >OphauB2|1701
ATGGCCACAGACTCCGGCCCCGACGCCCACGCAGCGCCAGAGACCATTGCAAACGCTGCTGAGCCAGAGTCTGAC
GAGTTTGGCCTGCCAATTCGGCGCTTTGTCACACCGATGCAAAAGCCGGCAGACGCCGACTGCAGCGCATCATGC
ACACAGCAGAGTGCCATTGACGCCCCAGACAAGCTGAATCAGCCCAAGTCCCATCAAGCTTCTTGCACACCGGCT
TTGGAAGGACAGGCTGCAGTAGCTAGCCAAGTCGACAGTGATAGCGACGACGCCCCCTTTGAGGATGCTCAACCA
GCATTCACATCCGCTGAGCATCATGAGCAGTCGTCCAGTCATGCTTCGCCCTTAAAGGCGCAAGGAGACGCTGCT
GCAACGCCCAAGCCGACATCTGCAGATTCCGAACCCCCAGCTCTCCCGACACCAGCCGCTTCTACCAAGGACGCC
CAGCTTTCGGCGGACCGAGATGCAGAGACAGCCTCAAGTACCCGCGAAGCCAATGTCGACAAGACACCACGGCCT
CCCGAAACCTCGGAGCCCGTAACAGCACATAGTCGAGATACCAGCGCAACTTCAAACTCCATAACTGGCCTCGGC
ATCTCCGAGTTTTCCCATCAACGGCTCTCGATGCAGCATGACAAGTTGGATCCAGAAGATGACCTCGGCTGGCAG
ACAATGCCATCGTATGCTCGGTATGACATGTACGATGATGATGACCGCCTTATTGCTCGAGAGCACAATGTGGAT
GAAGACGAGGCAGACGGCTATAGTGGCCTCGGAGGAGCTGGAAAAGGATATACGCGAGTCATCATGGACGAGGAC
GCTCAATCGGCTACAAGCATGGACGAGAATACCCAATACCTGTTCAAAGAAGCTAATGGCACAAGTGCAATGGGT
GAAGATGAAGGTCGCGATGCCGTTGCACAGATGCAAGCGACCAAGGACCTATTAACAGAGGGCCAGAGGATAGCA
TACGTCGGTGTCGTTCGCCTTGAAATATTCAACATGGTAAAGGAGGCTGAAGCAATCGAGTCGACCAAAAAGACA
AAAAAGGACCTGGCAACTTCAGCCGAGGCCATCAAGATGTGGGGTCAAAAAATGATGATTCGCCTGTACGCCCAT
ATGGACATTAGCGAAGCCGAGCAGGTCATGATTGAGCAGCTGGCGGAACATGGGGTGAGGCCGGCAGACCTTACT
CCAGCCCTTCACGCAAACTCGAGGGTCCACAACCCCATGGCAGAAGAAAAGGAGCCTAGCGGCAAGGGCCAGCAA
GAGGCATCTTCTCCATTATCGACTGGTGTAGTGGACGAACAGGCAGCAGAGCCGCTGCCACCGTATGAAGGGTTG
GGCAGCTCAGAAGTGCCACAGGTACAAACACCATCACAAATGCCGACAACGGAAAAGATTGACATTGATCTTCGG
TGGACAATTCTTTGCGATTTATTTCTTCTTCTCATTGCCGACTCCATCTATGATGCGCGCTCAAGAGTGCTCCTA
GAGCGCGTTGGTGCGAGCATAGAAATTACGTGGATTGATATTTGCAGGTTTGAGAAGAGGATAACGGACGCGCTC
GAGATGCAACAGGCAGCAGAGAAAGAAAACTGGAACGAAGACGAGCACATGGAGAGCCGGCGCAAAATGGCCCAG
AAGCGGCGCTATGTCATGATGGGACTGGCGACGGTTGGCGGCGGTCTTGTCATTGGTCTTTCGGCTGGTCTTTTG
GCACCTGTGATTGGCGCTGGACTGGCTGCAGGCTTCACCACGATTGGGGTAACGGGCACGAGCAGCTTTCTGGCC
GGTGCGGGTGGCGCAGCCATCATCACATCGTCAGCAGCTGCTTCGGGTAGCATCATTGGCGTCAGGGCGGCTAAT
CGCCGGACCGGAGCGGTCAAGACGTTTGAATACCGTCCACTGCACAACAACAAGCGCGTCAATCTTATAGTGACG
GTGTCTGGATGGCTAACGGGCAAGGTGGACGATGTGCGGCTACCCTTTAGCACCGTTGACCCCATCATGGGGGAC
ATCTACTCGGTCTTGTGGGAGCCTGAGATGCTGCGCAGCATGGGCGACACCATCAACATCCTAGCTACCGAGGCT
CTCACTCAGGGACTGCAGCAGATTCTGGGCAGCACGATACTCATCAGCCTGATGGCGGCACTGCAGCTGCCTATT
GTCTTGACTAAACTATCGTATCTGATTGATAACCCATGGGCCGTCTCTCTTGACCGAGCAACGGCGGCAGGCCTC
ATCTTGGCCGACTCGCTGCTGGAGCGCAGCCTGGGCACACGACCCATTACACTTGTCGGGTACTCCTTGGGCGCC
AGAGTCATCTTTTCGTGCATGCAGGAGCTGGCTAAAAAGGGGGCATACGGGCTGATTCAAAACGTTTACATGTTT
GGCTCGCCGATAGTGGTGAGGAAGGAAGAATACCTCCGAGCCCGCACTATTGTTTCGGGACGTTTTGTCAATGGC
TATAACCGCAACGACTGGATCCTTGGCTACCTCTTTCGGCTGACGAATGGCGGGATACGGCGAGTGGCGGGGCTG
GCGGCAATTGAGGACTGTCCATGGATGGAGAACATTGACGTGTCAGAACTTGTCGCTGGACACATGGAGTATCGA
AAGGCTATGCCTACACTGCTTATGAAATGTGGATGGATGGTGGAAAGCGACGAATTCACAGAAATCGAGGATCCG
GATCCTGACAACCACCAGGAACGACAAAGAGAACTCATCAATGAGATCGAGGAGGCGCGAAAGGAGCTTGAGAGA
GGAGCCAAGACGAAAAAGGCGAGCAAGTTTGCCCTGTTTGGTCGACGCAAGAAGGCGGAGAGACAGGAATGGGAG
GTTTATGAGGACTCGGCCGGCAAGGAGAACAAGGCCAGCAGTGGAGATGAAGGTACGAATACGGGTGTTTTATTC
GACATTGATGCGATTCGGGCCGAGCTGGCCAAAGAAGCAGCGCATCGAGGAGAAGTGGCGCAAGAGGAGCTGCAG
GTTCGGGAAATCAAATCGACGCTACCGCCCATGAAGCTCGACATGGCATCATCGTCATCGTCGACGTTGCCACTG
GCGTGCAAGGAAGAGGTGAATACGCTGCGCGAGACCAGAAGCGCCGAGGCGGTGAGCAGTAGCTTGCGGCATGCG
AGCGCGGGCTGGGGCGCAGACGACAAGAATGACGAATATGGCGGCGAGGGAGAGGAGGAGATTGACATGGTGTTT
GACACGTCGTTTGAGCCACGACACGGCGAAGAGGCAGGAAAGCCAAGCATGTGGGCGGCTCAAACGGTGCCGAAT
GTTACACTGGCGGATCCGTGGGCAGACGAAGACGAAGACTTTGGAAAGGAGCAGGAGATATCAATGACGTTTGCA
TAA
Gene >OphauB2|1701
ATGGCCACAGACTCCGGCCCCGACGCCCACGCAGCGCCAGAGACCATTGCAAACGCTGCTGAGCCAGAGTCTGAC
GAGTTTGGCCTGCCAATTCGGCGCTTTGTCACACCGATGCAAAAGCCGGCAGACGCCGACTGCAGCGCATCATGC
ACACAGCAGAGTGCCATTGACGCCCCAGACAAGCTGAATCAGCCCAAGTCCCATCAAGCTTCTTGCACACCGGCT
TTGGAAGGACAGGCTGCAGTAGCTAGCCAAGTCGACAGTGATAGCGACGACGCCCCCTTTGAGGATGCTCAACCA
GCATTCACATCCGCTGAGCATCATGAGCAGTCGTCCAGTCATGCTTCGCCCTTAAAGGCGCAAGGAGACGCTGCT
GCAACGCCCAAGCCGACATCTGCAGATTCCGAACCCCCAGCTCTCCCGACACCAGCCGCTTCTACCAAGGACGCC
CAGCTTTCGGCGGACCGAGATGCAGAGACAGCCTCAAGTACCCGCGAAGCCAATGTCGACAAGACACCACGGCCT
CCCGAAACCTCGGAGCCCGTAACAGCACATAGTCGAGATACCAGCGCAACTTCAAACTCCATAACTGGCCTCGGC
ATCTCCGAGTTTTCCCATCAACGGCTCTCGATGCAGCATGACAAGTTGGATCCAGAAGATGACCTCGGCTGGCAG
ACAATGCCATCGTATGCTCGGTATGACATGTACGATGATGATGACCGCCTTATTGCTCGAGAGCACAATGTGGAT
GAAGACGAGGCAGACGGCTATAGTGGCCTCGGAGGAGCTGGAAAAGGATATACGCGAGTCATCATGGACGAGGAC
GCTCAATCGGCTACAAGCATGGACGAGAATACCCAATACCTGTTCAAAGAAGCTAATGGCACAAGTGCAATGGGT
GAAGATGAAGGTCGCGATGCCGTTGCACAGATGCAAGCGACCAAGGACCTATTAACAGAGGGCCAGAGGATAGCA
TACGTCGGTGTCGTTCGCCTTGAAATATTCAACATGGTAAAGGAGGCTGAAGCAATCGAGTCGACCAAAAAGACA
AAAAAGGACCTGGCAACTTCAGCCGAGGCCATCAAGATGTGGGGTCAAAAAATGATGATTCGCCTGTACGCCCAT
ATGGACATTAGCGAAGCCGAGCAGGTCATGATTGAGCAGCTGGCGGAACATGGGGTGAGGCCGGCAGACCTTACT
CCAGCCCTTCACGCAAACTCGAGGGTCCACAACCCCATGGCAGAAGAAAAGGAGCCTAGCGGCAAGGGCCAGCAA
GAGGCATCTTCTCCATTATCGACTGGTGTAGTGGACGAACAGGCAGCAGAGCCGCTGCCACCGTATGAAGGGTTG
GGCAGCTCAGAAGTGCCACAGGTACAAACACCATCACAAATGCCGACAACGGAAAAGATTGACATTGATCTTCGG
TGGACAATTCTTTGCGATTTATTTCTTCTTCTCATTGCCGACTCCATCTATGATGCGCGCTCAAGAGTGCTCCTA
GAGCGCGTTGGTGCGAGCATAGAAATTACGTGGATTGATATTTGCAGGTTTGAGAAGAGGATAACGGACGCGCTC
GAGATGCAACAGGCAGCAGAGAAAGAAAACTGGAACGAAGACGAGCACATGGAGAGCCGGCGCAAAATGGCCCAG
AAGCGGCGCTATGTCATGATGGGACTGGCGACGGTTGGCGGCGGTCTTGTCATTGGTCTTTCGGCTGGTCTTTTG
GCACCTGTGATTGGCGCTGGACTGGCTGCAGGCTTCACCACGATTGGGGTAACGGGCACGAGCAGCTTTCTGGCC
GGTGCGGGTGGCGCAGCCATCATCACATCGTCAGCAGCTGCTTCGGGTAGCATCATTGGCGTCAGGGCGGCTAAT
CGCCGGACCGGAGCGGTCAAGACGTTTGAATACCGTCCACTGCACAACAACAAGCGCGTCAATCTTATAGTGACG
GTGTCTGGATGGCTAACGGGCAAGGTGGACGATGTGCGGCTACCCTTTAGCACCGTTGACCCCATCATGGGGGAC
ATCTACTCGGTCTTGTGGGAGCCTGAGATGCTGCGCAGCATGGGCGACACCATCAACATCCTAGCTACCGAGGTA
TGCCCTTTGACCTGTTCTTTTGACTGCAATGCACAAGGTTGAAGTCTCTGACCAAGAATGGCAGGCTCTCACTCA
GGGACTGCAGCAGATTCTGGGCAGCACGATACTCATCAGCCTGATGGCGGCACTGCAGCTGCCTATTGTCTTGAC
TAAACTATCGTATCTGATTGATAACCCATGGGCCGTCTCTCTTGACCGAGCAACGGCGGCAGGCCTCATCTTGGC
CGACTCGCTGCTGGAGCGCAGCCTGGGCACACGACCCATTACACTTGTCGGGTACTCCTTGGGCGCCAGAGTCAT
CTTTTCGTGCATGCAGGAGCTGGCTAAAAAGGGGGCATACGGGCTGATTCAAAACGTTTACATGTTTGGCTCGCC
GATAGTGGTGAGGAAGGAAGAATACCTCCGAGCCCGCACTATTGTTTCGGGACGTTTTGTCAATGGCTATAACCG
CAACGACTGGATCCTTGGCTACCTCTTTCGGCTGACGAATGGCGGGATACGGCGAGTGGCGGGGCTGGCGGCAAT
TGAGGACTGTCCATGGATGGAGAACATTGACGTGTCAGAACTTGTCGCTGGACACATGGAGTATCGAAAGGCTAT
GCCTACACTGCTTATGAAATGTGGATGGATGGTGGAAAGCGACGAATTCACAGAAATCGAGGATCCGGATCCTGA
CAACCACCAGGAACGACAAAGAGAACTCATCAATGAGATCGAGGAGGCGCGAAAGGAGCTTGAGAGAGGAGCCAA
GACGAAAAAGGCGAGCAAGTTTGCCCTGTTTGGTCGACGCAAGAAGGCGGAGAGACAGGAATGGGAGGTTTATGA
GGACTCGGCCGGCAAGGAGAACAAGGCCAGCAGTGGAGATGAAGGTACGAATACGGGTGTTTTATTCGACATTGA
TGCGATTCGGGCCGAGCTGGCCAAAGAAGCAGCGCATCGAGGAGAAGTGGCGCAAGAGGAGCTGCAGGTTCGGGA
AATCAAATCGACGCTACCGCCCATGAAGCTCGACATGGCATCATCGTCATCGTCGACGTTGCCACTGGCGTGCAA
GGAAGAGGTGAATACGCTGCGCGAGACCAGAAGCGCCGAGGCGGTGAGCAGTAGCTTGCGGCATGCGAGCGCGGG
CTGGGGCGCAGACGACAAGAATGACGAATATGGCGGCGAGGGAGAGGAGGAGATTGACATGGTGTTTGACACGTC
GTTTGAGCCACGACACGGCGAAGAGGCAGGAAAGCCAAGCATGTGGGCGGCTCAAACGGTGCCGAATGTTACACT
GGCGGATCCGTGGGCAGACGAAGACGAAGACTTTGGAAAGGAGCAGGAGATATCAATGACGTTTGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail