Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1700
Gene name
LocationContig_149:6046..8604
Strand-
Gene length (bp)2558
Transcript length (bp)2388
Coding sequence length (bp)2388
Protein length (aa) 796

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 257 630 2.0E-10
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 169 628 1.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 334 356 22
2 366 388 22
3 395 417 22
4 465 487 22
5 520 542 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1700
MGGSRRTVAASSVGQRRGGADFDSWRAMADSRRHIRLPSPATERRPLLPTRSYSRRGGGGGGGGGGGGGRRGRRG
SGGRGGSWHEYDDDDDEDDDDDEGDDDEDGDRVYSCMTNPHSHLPVYTNIHRIRRDITSVVEDYLSLEQLRDVRI
NVTVIRPLVDKFYELDDISIVYCLLVNRAQFLAEESHSSHRQNVNWTRATLCELIATRILRRFGEDHEGPDGLLL
LAHILVAGFEPFQNAPTPIRAEAEATTAWTYRRALPALEVAILTESKHLLSSTTCQRVVTAVYEGRIIYTPSTIW
DVIPDHYKLRPISLYDPRESPLLNQYRLIVPRTRNILEAIQFAILLCLYVCVMLMRSSARLTAVEVFFDIYAFGW
GLDQFATILAHGWNVYTQNLWSFLDVAFVLIYSVYLVLRLYGLTSGSQGAAAQALDVLALAAPVLVPRLAFTLLS
DNLVFLSLRSMMADFFFLTALSAWCFFGFLLSLLWLGEGTHPLVTISKWMIYIWFGLDGTGIQRSTEFHWLLGPS
VMVTFAFLGNTLFLTILVSMLSNTFSNISTNATAEIQFRRAVLTLEGVKADAIFAYQPPFNLLAVFLLLPLKSVA
SPRWFHKIHVTSVRLVNLPLLLMIAVAERRLLWPPSSTGQAETYAPLPRRRFWQKWQLSAHRYLGAVYQVPPPQD
VYHDIAVDDDLTHHLIRRQFTRPNPADPQVRKPSRRDSMFPGLASKLRGSFNDNGGDLDSMAAKVNGLEQSMQRI
ESLLSKLVMQGDIATDESLQAAKESSTLQPGDGFTAESSYQAGGS*
Coding >OphauB2|1700
ATGGGCGGTAGTCGGCGCACAGTAGCAGCGTCGAGCGTTGGGCAGCGGCGCGGGGGCGCAGATTTTGATTCGTGG
CGGGCCATGGCTGATAGCAGACGACACATCAGACTGCCCTCACCGGCGACTGAGCGACGGCCGCTGCTGCCGACG
AGGTCGTATTCGCGCCGAGGAGGGGGAGGAGGAGGAGGAGGAGGAGGGGGAGGAGGCAGAAGAGGCAGGCGAGGG
AGTGGCGGCCGTGGGGGCAGCTGGCACGAATACGACGACGACGACGACGAGGATGACGACGACGACGAGGGCGAC
GACGACGAGGATGGCGACCGCGTCTACAGCTGCATGACCAACCCGCACAGCCACCTGCCCGTGTACACAAACATC
CACCGCATCCGGCGCGACATCACCAGCGTGGTGGAGGACTATCTCAGCCTGGAGCAGCTGCGCGACGTGCGCATC
AACGTGACGGTGATTCGGCCGCTGGTGGACAAGTTTTACGAGCTCGACGACATCTCCATTGTCTACTGTCTGCTG
GTCAACCGGGCGCAGTTTCTGGCGGAGGAATCGCATTCCAGCCACCGGCAAAACGTCAACTGGACGCGGGCGACA
CTGTGCGAGCTCATCGCGACGCGCATCCTGCGGCGCTTTGGCGAGGACCACGAGGGGCCCGACGGGCTGCTGCTG
CTGGCGCACATCCTCGTGGCCGGCTTCGAGCCCTTTCAGAATGCACCGACACCCATCCGCGCCGAGGCCGAGGCG
ACAACGGCGTGGACATACCGCCGCGCCCTGCCTGCGCTCGAGGTGGCCATTCTGACGGAGAGCAAGCACCTGCTC
AGCTCCACCACGTGCCAGCGCGTCGTCACGGCCGTCTACGAGGGCCGCATCATCTACACGCCCTCGACCATCTGG
GACGTGATTCCCGACCACTACAAGCTGCGGCCCATCTCGCTCTACGACCCGCGCGAGTCGCCGCTGCTCAACCAG
TACCGCCTCATTGTCCCGCGCACCCGCAACATCCTCGAGGCCATTCAGTTTGCCATTCTGCTCTGCCTCTACGTC
TGCGTCATGCTCATGCGCAGCAGCGCCAGGCTCACCGCCGTCGAGGTGTTTTTTGACATCTATGCCTTTGGCTGG
GGCCTGGACCAGTTTGCCACCATTTTGGCCCACGGATGGAACGTCTACACACAGAACCTGTGGTCCTTTCTCGAC
GTAGCCTTTGTCCTCATCTACAGCGTCTACCTTGTTCTGCGTCTCTACGGCCTCACCTCGGGCTCCCAGGGCGCC
GCCGCACAGGCGCTCGACGTCCTTGCTCTCGCCGCCCCCGTCCTCGTGCCCCGCCTTGCCTTTACCCTCCTCTCG
GACAACCTTGTCTTTCTCTCTCTTCGATCCATGATGGCAGACTTTTTCTTCCTCACCGCTCTGTCGGCCTGGTGT
TTCTTTGGCTTCCTCCTCTCCCTGCTGTGGCTGGGCGAGGGGACGCACCCTCTGGTCACCATCTCCAAGTGGATG
ATTTACATTTGGTTTGGCCTCGACGGCACTGGCATCCAGCGCTCGACCGAGTTCCACTGGCTTCTAGGGCCCAGC
GTCATGGTGACTTTTGCCTTTCTCGGCAACACGCTGTTTCTCACCATACTTGTGTCGATGCTGTCAAACACGTTT
AGCAACATCTCGACCAATGCCACGGCCGAGATTCAGTTTCGTCGAGCCGTCTTGACGCTCGAGGGCGTCAAGGCC
GACGCCATCTTTGCCTACCAGCCGCCCTTTAACCTCTTGGCCGTCTTTCTCCTCCTGCCCCTCAAGTCTGTTGCC
AGCCCGCGCTGGTTTCACAAGATACACGTCACCAGCGTGCGCCTTGTCAACCTGCCCTTGCTGCTCATGATTGCC
GTGGCAGAGCGGCGCTTGCTGTGGCCACCCAGCTCAACGGGCCAAGCCGAGACGTATGCTCCGCTTCCCAGACGG
CGCTTCTGGCAAAAGTGGCAGCTCTCGGCCCACCGCTATCTAGGCGCCGTCTACCAAGTGCCGCCCCCTCAAGAT
GTCTACCATGACATTGCCGTCGATGATGATTTGACGCACCATCTCATCCGCCGGCAGTTTACCAGGCCCAATCCT
GCAGATCCGCAAGTGCGCAAGCCGTCGCGCCGAGACTCCATGTTTCCCGGCTTGGCAAGCAAGCTGCGAGGCTCC
TTCAACGACAATGGCGGTGATTTGGACTCCATGGCAGCAAAGGTGAATGGCTTGGAGCAGTCGATGCAGCGCATC
GAGTCTTTGTTGTCCAAGCTGGTGATGCAGGGCGACATTGCCACCGACGAGTCGCTCCAAGCGGCCAAGGAGAGC
AGCACGCTGCAGCCAGGCGACGGCTTTACTGCCGAGTCGTCGTACCAGGCCGGAGGGTCATGA
Transcript >OphauB2|1700
ATGGGCGGTAGTCGGCGCACAGTAGCAGCGTCGAGCGTTGGGCAGCGGCGCGGGGGCGCAGATTTTGATTCGTGG
CGGGCCATGGCTGATAGCAGACGACACATCAGACTGCCCTCACCGGCGACTGAGCGACGGCCGCTGCTGCCGACG
AGGTCGTATTCGCGCCGAGGAGGGGGAGGAGGAGGAGGAGGAGGAGGGGGAGGAGGCAGAAGAGGCAGGCGAGGG
AGTGGCGGCCGTGGGGGCAGCTGGCACGAATACGACGACGACGACGACGAGGATGACGACGACGACGAGGGCGAC
GACGACGAGGATGGCGACCGCGTCTACAGCTGCATGACCAACCCGCACAGCCACCTGCCCGTGTACACAAACATC
CACCGCATCCGGCGCGACATCACCAGCGTGGTGGAGGACTATCTCAGCCTGGAGCAGCTGCGCGACGTGCGCATC
AACGTGACGGTGATTCGGCCGCTGGTGGACAAGTTTTACGAGCTCGACGACATCTCCATTGTCTACTGTCTGCTG
GTCAACCGGGCGCAGTTTCTGGCGGAGGAATCGCATTCCAGCCACCGGCAAAACGTCAACTGGACGCGGGCGACA
CTGTGCGAGCTCATCGCGACGCGCATCCTGCGGCGCTTTGGCGAGGACCACGAGGGGCCCGACGGGCTGCTGCTG
CTGGCGCACATCCTCGTGGCCGGCTTCGAGCCCTTTCAGAATGCACCGACACCCATCCGCGCCGAGGCCGAGGCG
ACAACGGCGTGGACATACCGCCGCGCCCTGCCTGCGCTCGAGGTGGCCATTCTGACGGAGAGCAAGCACCTGCTC
AGCTCCACCACGTGCCAGCGCGTCGTCACGGCCGTCTACGAGGGCCGCATCATCTACACGCCCTCGACCATCTGG
GACGTGATTCCCGACCACTACAAGCTGCGGCCCATCTCGCTCTACGACCCGCGCGAGTCGCCGCTGCTCAACCAG
TACCGCCTCATTGTCCCGCGCACCCGCAACATCCTCGAGGCCATTCAGTTTGCCATTCTGCTCTGCCTCTACGTC
TGCGTCATGCTCATGCGCAGCAGCGCCAGGCTCACCGCCGTCGAGGTGTTTTTTGACATCTATGCCTTTGGCTGG
GGCCTGGACCAGTTTGCCACCATTTTGGCCCACGGATGGAACGTCTACACACAGAACCTGTGGTCCTTTCTCGAC
GTAGCCTTTGTCCTCATCTACAGCGTCTACCTTGTTCTGCGTCTCTACGGCCTCACCTCGGGCTCCCAGGGCGCC
GCCGCACAGGCGCTCGACGTCCTTGCTCTCGCCGCCCCCGTCCTCGTGCCCCGCCTTGCCTTTACCCTCCTCTCG
GACAACCTTGTCTTTCTCTCTCTTCGATCCATGATGGCAGACTTTTTCTTCCTCACCGCTCTGTCGGCCTGGTGT
TTCTTTGGCTTCCTCCTCTCCCTGCTGTGGCTGGGCGAGGGGACGCACCCTCTGGTCACCATCTCCAAGTGGATG
ATTTACATTTGGTTTGGCCTCGACGGCACTGGCATCCAGCGCTCGACCGAGTTCCACTGGCTTCTAGGGCCCAGC
GTCATGGTGACTTTTGCCTTTCTCGGCAACACGCTGTTTCTCACCATACTTGTGTCGATGCTGTCAAACACGTTT
AGCAACATCTCGACCAATGCCACGGCCGAGATTCAGTTTCGTCGAGCCGTCTTGACGCTCGAGGGCGTCAAGGCC
GACGCCATCTTTGCCTACCAGCCGCCCTTTAACCTCTTGGCCGTCTTTCTCCTCCTGCCCCTCAAGTCTGTTGCC
AGCCCGCGCTGGTTTCACAAGATACACGTCACCAGCGTGCGCCTTGTCAACCTGCCCTTGCTGCTCATGATTGCC
GTGGCAGAGCGGCGCTTGCTGTGGCCACCCAGCTCAACGGGCCAAGCCGAGACGTATGCTCCGCTTCCCAGACGG
CGCTTCTGGCAAAAGTGGCAGCTCTCGGCCCACCGCTATCTAGGCGCCGTCTACCAAGTGCCGCCCCCTCAAGAT
GTCTACCATGACATTGCCGTCGATGATGATTTGACGCACCATCTCATCCGCCGGCAGTTTACCAGGCCCAATCCT
GCAGATCCGCAAGTGCGCAAGCCGTCGCGCCGAGACTCCATGTTTCCCGGCTTGGCAAGCAAGCTGCGAGGCTCC
TTCAACGACAATGGCGGTGATTTGGACTCCATGGCAGCAAAGGTGAATGGCTTGGAGCAGTCGATGCAGCGCATC
GAGTCTTTGTTGTCCAAGCTGGTGATGCAGGGCGACATTGCCACCGACGAGTCGCTCCAAGCGGCCAAGGAGAGC
AGCACGCTGCAGCCAGGCGACGGCTTTACTGCCGAGTCGTCGTACCAGGCCGGAGGGTCATGA
Gene >OphauB2|1700
ATGGGCGGTAGTCGGCGCACAGTAGCAGCGTCGAGCGTTGGGCAGCGGCGCGGGGGCGCAGATTTTGATTCGTGG
CGGGCCATGGCTGATAGCAGACGACACATCAGACTGCCCTCACCGGCGACTGAGCGACGGCCGCTGCTGCCGACG
AGGTCGTATTCGCGCCGAGGAGGGGGAGGAGGAGGAGGAGGAGGAGGGGGAGGAGGCAGAAGAGGCAGGCGAGGG
AGTGGCGGCCGTGGGGGCAGCTGGCACGAATACGACGACGACGACGACGAGGATGACGACGACGACGAGGGCGAC
GACGACGAGGATGGCGACCGCGTCTACAGCTGCATGACCAACCCGCACAGCCACCTGCCCGTGTACACAAACATC
CACCGCATCCGGCGCGACATCACCAGCGTGGTGGAGGACTATCTCAGCCTGGAGCAGCTGCGCGACGTGCGCATC
AACGTGACGGTGATTCGGCCGCTGGTGGACAAGTTTTACGAGCTCGACGACATCTCCATTGTCTACTGTCTGCTG
GTCAACCGGGCGCAGTTTCTGGCGGAGGAATCGCATTCCAGCCACCGGCAAAACGTCAACTGGACGCGGGCGACA
CTGTGCGAGCTCATCGCGACGCGCATCCTGCGGCGCTTTGGCGAGGACCACGAGGGGCCCGACGGGCTGCTGCTG
CTGGCGCACATCCTCGTGGCCGGCTTCGAGCCCTTTCAGAATGCACCGACACCCATCCGCGCCGAGGCCGAGGCG
ACAACGGCGTGGACATACCGCCGCGCCCTGCCTGCGCTCGAGGTGGCCATTCTGACGGAGAGCAAGCACCTGCTC
AGCTCCACCACGTGCCAGCGCGTCGTCACGGCCGTCTACGAGGGCCGCATCATCTACACGCCCTCGACCATCTGG
GACGTGATTCCCGACCACTACAAGCTGCGGCCCATCTCGCTCTACGACCCGCGCGAGTCGCCGCTGCTCAACCAG
TACCGCCTCATTGTCCCGCGCACCCGCAACATCCTCGAGGCCATTCAGTTTGCCATTCTGCTCTGCCTCTACGTC
TGCGTCATGCTCATGCGCAGCAGCGCCAGGCTCACCGCCGTCGAGGTGTTTTTTGACATCTATGCCTTTGGCTGG
GGCCTGGACCAGTTTGCCACCATTTTGGCCCACGGATGGTGAGCAAGCTTGGCTTCCATGGCGCTGCCCTGTACT
CACCCGCTGCCTAGGAACGTCTACACACAGAACCTGTGGTCCTTTCTCGACGTAGCCTTTGTCCTCATCTACAGC
GTCTACCTTGTTCTGCGTCTCTACGGCCTCACCTCGGGCTCCCAGGGCGCCGCCGCACAGGCGCTCGACGTCCTT
GCTCTCGCCGCCCCCGTCCTCGTGCCCCGCCTTGCCTTTACCCTCCTCTCGGACAACCTTGTCTTTCTCTCTCTT
CGATCCATGATGGCAGACTTTTTCTTCCTCACCGCTCTGTCGGCCTGGTGTTTCTTTGGCTTCCTCCTCTCCCTG
CTGTGGCTGGGCGAGGGGACGCACCCTCTGGTGTGAGTTTGCCTCCCTTGCTCTACATGCTAGTTTGGCTGACCC
AAGTGACTGCTGATAGCACCATCTCCAAGTGGATGATTTACATTTGGTTTGGCCTCGACGGCACTGGCATCCAGC
GCTCGGTAAGGCCCTCTGGCACGCCATCTCGCCACAAGACGCCCCCACTGACGCGCGCTGTCTAGACCGAGTTCC
ACTGGCTTCTAGGGCCCAGCGTCATGGTGACTTTTGCCTTTCTCGGCAACACGCTGTTTCTCACCATACTTGTGT
CGATGCTGTCAAACACGTTTAGCAACATCTCGACCAATGCCACGGCCGAGATTCAGTTTCGTCGAGCCGTCTTGA
CGCTCGAGGGCGTCAAGGCCGACGCCATCTTTGCCTACCAGCCGCCCTTTAACCTCTTGGCCGTCTTTCTCCTCC
TGCCCCTCAAGTCTGTTGCCAGCCCGCGCTGGTTTCACAAGATACACGTCACCAGCGTGCGCCTTGTCAACCTGC
CCTTGCTGCTCATGATTGCCGTGGCAGAGCGGCGCTTGCTGTGGCCACCCAGCTCAACGGGCCAAGCCGAGACGT
ATGCTCCGCTTCCCAGACGGCGCTTCTGGCAAAAGTGGCAGCTCTCGGCCCACCGCTATCTAGGCGCCGTCTACC
AAGTGCCGCCCCCTCAAGATGTCTACCATGACATTGCCGTCGATGATGATTTGACGCACCATCTCATCCGCCGGC
AGTTTACCAGGCCCAATCCTGCAGATCCGCAAGTGCGCAAGCCGTCGCGCCGAGACTCCATGTTTCCCGGCTTGG
CAAGCAAGCTGCGAGGCTCCTTCAACGACAATGGCGGTGATTTGGACTCCATGGCAGCAAAGGTGAATGGCTTGG
AGCAGTCGATGCAGCGCATCGAGTCTTTGTTGTCCAAGCTGGTGATGCAGGGCGACATTGCCACCGACGAGTCGC
TCCAAGCGGCCAAGGAGAGCAGCACGCTGCAGCCAGGCGACGGCTTTACTGCCGAGTCGTCGTACCAGGCCGGAG
GGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail