Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1696
Gene name
LocationContig_148:49646..52999
Strand+
Gene length (bp)3353
Transcript length (bp)3246
Coding sequence length (bp)3246
Protein length (aa) 1082

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01074 Glyco_hydro_38N Glycosyl hydrolases family 38 N-terminal domain 7.2E-88 283 546
PF07748 Glyco_hydro_38C Glycosyl hydrolases family 38 C-terminal domain 1.8E-48 719 926
PF09261 Alpha-mann_mid Alpha mannosidase middle domain 1.6E-27 553 648
PF17677 Glyco_hydro38C2 Glycosyl hydrolases family 38 C-terminal beta sandwich domain 7.5E-09 1017 1078

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT61|MAN1_SCHPO Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ams1 PE=3 SV=1 14 1081 0.0E+00
sp|P22855|MAN1_YEAST Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMS1 PE=1 SV=2 19 1079 0.0E+00
sp|Q54K67|MANG_DICDI Alpha-mannosidase G OS=Dictyostelium discoideum GN=manG PE=1 SV=1 32 1079 0.0E+00
sp|Q91W89|MA2C1_MOUSE Alpha-mannosidase 2C1 OS=Mus musculus GN=Man2c1 PE=1 SV=1 32 1081 0.0E+00
sp|Q9NTJ4|MA2C1_HUMAN Alpha-mannosidase 2C1 OS=Homo sapiens GN=MAN2C1 PE=1 SV=1 32 1072 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT61|MAN1_SCHPO Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ams1 PE=3 SV=1 14 1081 0.0E+00
sp|P22855|MAN1_YEAST Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AMS1 PE=1 SV=2 19 1079 0.0E+00
sp|Q54K67|MANG_DICDI Alpha-mannosidase G OS=Dictyostelium discoideum GN=manG PE=1 SV=1 32 1079 0.0E+00
sp|Q91W89|MA2C1_MOUSE Alpha-mannosidase 2C1 OS=Mus musculus GN=Man2c1 PE=1 SV=1 32 1081 0.0E+00
sp|Q9NTJ4|MA2C1_HUMAN Alpha-mannosidase 2C1 OS=Homo sapiens GN=MAN2C1 PE=1 SV=1 32 1072 0.0E+00
sp|P21139|MA2C1_RAT Alpha-mannosidase 2C1 OS=Rattus norvegicus GN=Man2c1 PE=1 SV=1 32 1081 0.0E+00
sp|P54746|MNGB_ECOLI Mannosylglycerate hydrolase OS=Escherichia coli (strain K12) GN=mngB PE=1 SV=2 289 680 3.0E-16
sp|P49641|MA2A2_HUMAN Alpha-mannosidase 2x OS=Homo sapiens GN=MAN2A2 PE=2 SV=3 284 627 9.0E-11
sp|Q8BRK9|MA2A2_MOUSE Alpha-mannosidase 2x OS=Mus musculus GN=Man2a2 PE=1 SV=2 284 651 3.0E-10
sp|Q9KER1|MNGB_BACHD Putative mannosylglycerate hydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mngB PE=3 SV=2 790 1080 3.0E-08
sp|P27046|MA2A1_MOUSE Alpha-mannosidase 2 OS=Mus musculus GN=Man2a1 PE=1 SV=2 284 654 5.0E-08
sp|Q16706|MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens GN=MAN2A1 PE=1 SV=2 284 461 1.0E-07
sp|Q9KER1|MNGB_BACHD Putative mannosylglycerate hydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mngB PE=3 SV=2 287 452 7.0E-07
sp|P28494|MA2A1_RAT Alpha-mannosidase 2 OS=Rattus norvegicus GN=Man2a1 PE=1 SV=2 284 653 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004559 alpha-mannosidase activity Yes
GO:0006013 mannose metabolic process Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0005996 monosaccharide metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0015923 mannosidase activity No
GO:0019318 hexose metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1696
MGGGGDVGTEKSSFPVFAHRPVGVPKTSILKQRIELFYRSTQYERVNLLAKLYNGRVSGKPHVKLYVWSAPGQER
PSFNDAVSHEFKETRTGASFGPSWTTHWFRLHLTVPKEMMKEELVVLEWDANNEAMVWSHDGMPLQGLTGGDERI
EWIIPKAMRDGKEHVIYIEMACNGMFGNAPSGRPSIAPPAPDRYFSLSKANIAAPNVPARALYFDMWELGDAARE
LPEDSAEETKALAVAMEIIDTFQVDNQESILQCRRLAQQIIGPDVDSHRVYDVGKEGTVFGIGHCHIDTCWLWPW
AETRRKVCRSWSSQCDLMDRYPEAHFACSQAQQFKWLKEYYPKAFERVKAKVKEGQFHPIGGSWVEHDTNMPSGE
SLVRQFFYGQRFFESEFGSRCRTFWLPDTFGYTSQLPQLCRLAGMDRFMTQKLSWNNINNFPHTTFMWVSPDGSQ
VICHMPPSETYTSDADFGDVRRSITQHKTMRVDSSSLLVYGKGDGGGGPTWEHFEKLRRCAGISNTIGGIPKLKL
GLTVDEFFDRLAPKANDFPTWVGELYFELHRGTYTTQANNKLFNRKAEVMLRDIEQLATFASIKSKDYKYPSADI
DEMWQAVLLCQFHDCLPGSSIEMCYQDSTKLYTQVFGKGQKLLDELYKILGTSTEHPQSLRATVAANTLPWHRHE
LVEVSETEVGVACGGGQLLPVHAFTPKDDGPAVTVTQKGNDFILESDHLRLVVKEGCISSLYDRVNDHEVVEAGA
QANKFVLFDDIPLYWEAWDVEVYHLETRREVEYGTTAIHEKKAHKVTLVTDIKISHESSLKSYITLWAAIKDQPS
RVDCSAEVDWHENSKFLKVEFPVNVVSPDASYESAYSITKRPTHYNTSWDMAKFEVCCHKFADLSEHNYGVSILN
DSKYGFATAGKTMRLSLLRSPKAPDGNADMGHHSIRWAIFPHRGSLSSATVKAAYAFNNPLKLLSASQATLDHVA
AQQAPIKLVNLDDSESLVLDAIKRGHGDQDLGPHQGLPVNKGRSVILRIYESLGGHSRGEIQTQFDVRRVVKTNV
LEDEVEEVKFDAGKFSIRLRPFEVATFKLEL*
Coding >OphauB2|1696
ATGGGTGGTGGCGGTGATGTCGGGACTGAAAAGTCCTCGTTCCCCGTCTTTGCTCACAGGCCCGTAGGCGTGCCC
AAGACGAGCATTCTCAAGCAGCGCATTGAGCTCTTCTACAGATCGACCCAGTATGAGAGGGTCAATCTGCTGGCA
AAGCTCTACAATGGCAGAGTCTCGGGAAAGCCTCATGTCAAACTCTACGTCTGGAGCGCCCCAGGACAGGAGCGC
CCCAGCTTCAATGATGCTGTTTCTCATGAGTTCAAGGAGACGCGGACTGGCGCCTCGTTTGGCCCGTCATGGACG
ACGCACTGGTTCAGACTTCATCTGACGGTGCCCAAGGAGATGATGAAGGAGGAGCTTGTTGTGCTCGAATGGGAT
GCGAACAACGAGGCCATGGTGTGGTCGCACGACGGCATGCCTCTGCAGGGCCTCACAGGCGGCGACGAGCGCATT
GAATGGATCATTCCCAAGGCGATGCGCGACGGCAAGGAACACGTCATCTACATTGAGATGGCGTGCAACGGCATG
TTTGGCAATGCCCCCAGCGGCAGACCTAGTATCGCTCCGCCTGCCCCAGACAGGTACTTTAGCCTCAGCAAAGCC
AATATTGCCGCTCCCAATGTGCCTGCCCGCGCCCTCTACTTTGACATGTGGGAGCTTGGCGATGCCGCTCGCGAG
CTTCCAGAGGACTCGGCAGAGGAGACCAAGGCTCTGGCCGTGGCCATGGAAATCATTGACACGTTTCAAGTTGAC
AATCAAGAGTCTATTCTCCAATGCCGCCGTCTTGCCCAGCAAATCATCGGACCCGATGTCGACTCGCACCGCGTC
TACGACGTTGGCAAGGAGGGCACCGTCTTTGGTATTGGCCACTGTCACATTGATACGTGCTGGCTATGGCCATGG
GCTGAGACGAGACGCAAAGTCTGTCGCTCGTGGTCGAGCCAGTGCGACCTCATGGACCGCTATCCCGAGGCGCAT
TTTGCTTGCTCCCAGGCCCAGCAGTTCAAGTGGCTCAAGGAATACTATCCCAAAGCCTTTGAGCGTGTCAAGGCC
AAGGTCAAGGAGGGCCAGTTCCACCCCATTGGAGGCAGCTGGGTCGAGCACGACACCAATATGCCAAGCGGCGAA
TCCCTTGTCCGCCAGTTCTTCTATGGCCAGAGGTTCTTTGAGTCCGAGTTTGGCTCGCGCTGCCGCACTTTCTGG
CTGCCTGACACGTTTGGCTACACGAGCCAGCTGCCGCAGCTCTGCCGCCTGGCCGGCATGGACCGCTTCATGACG
CAGAAGCTCAGCTGGAACAACATCAACAACTTTCCTCACACGACATTTATGTGGGTGAGCCCCGACGGCAGCCAA
GTCATTTGCCACATGCCGCCCTCGGAGACTTACACATCCGACGCCGACTTTGGCGACGTGAGGCGCAGCATCACA
CAACACAAGACGATGCGAGTGGATAGCTCGTCGCTGCTCGTCTATGGCAAAGGCGACGGTGGCGGCGGCCCTACC
TGGGAGCATTTTGAAAAGCTTCGCCGCTGCGCCGGCATCAGCAACACAATTGGTGGCATTCCAAAGCTCAAGCTC
GGCCTCACGGTTGATGAGTTTTTTGACCGTCTGGCTCCCAAGGCCAACGACTTCCCTACCTGGGTTGGAGAGCTT
TACTTTGAGCTTCACCGCGGCACCTATACAACTCAGGCCAACAATAAGCTCTTCAACCGCAAGGCCGAGGTGATG
CTCCGTGACATTGAGCAGCTGGCCACGTTTGCCTCGATCAAATCCAAAGACTACAAGTATCCGTCGGCCGACATT
GACGAAATGTGGCAAGCCGTCTTGCTCTGCCAGTTCCACGACTGCCTTCCCGGAAGCTCTATTGAGATGTGCTAT
CAAGACTCAACCAAGCTCTATACCCAAGTCTTTGGCAAAGGCCAGAAACTGCTTGATGAATTGTATAAAATACTG
GGCACCTCGACTGAGCACCCGCAGTCTTTGCGCGCAACAGTTGCCGCCAATACACTGCCCTGGCATCGCCATGAG
CTCGTTGAAGTCTCTGAGACGGAAGTGGGAGTAGCCTGTGGTGGCGGCCAGCTGCTTCCTGTGCATGCTTTTACG
CCCAAGGACGACGGCCCAGCAGTAACTGTGACGCAAAAGGGTAACGACTTTATACTGGAGAGCGACCATTTGCGC
CTTGTTGTAAAGGAAGGCTGCATCTCGTCTCTGTATGACCGTGTCAACGACCACGAGGTGGTTGAAGCAGGCGCC
CAGGCCAACAAGTTTGTCCTGTTTGACGACATTCCTCTGTATTGGGAGGCTTGGGATGTCGAGGTCTATCACCTC
GAGACGCGCAGAGAGGTGGAGTACGGCACGACGGCAATTCATGAAAAGAAAGCCCACAAAGTGACGCTGGTTACC
GACATCAAAATTAGCCACGAGAGCTCCCTCAAGTCATACATCACCCTTTGGGCAGCCATCAAGGACCAGCCGTCG
AGGGTGGATTGCTCTGCCGAGGTGGATTGGCACGAGAACTCCAAGTTCCTCAAGGTTGAGTTTCCTGTCAATGTG
GTGAGCCCGGATGCCTCGTATGAGTCGGCCTATAGCATCACGAAGCGACCGACGCATTACAATACCAGTTGGGAC
ATGGCCAAGTTTGAGGTGTGCTGCCACAAGTTTGCCGATTTATCCGAGCACAACTATGGCGTCTCTATTCTCAAT
GACAGCAAGTATGGCTTCGCCACGGCGGGCAAGACGATGCGCCTGTCACTTCTGCGCTCTCCCAAGGCACCAGAC
GGCAACGCCGACATGGGCCACCATTCAATTCGCTGGGCCATTTTCCCCCACCGAGGCTCTCTATCGTCGGCCACG
GTCAAGGCGGCCTATGCCTTCAACAACCCCCTCAAGTTGCTTTCGGCGTCGCAGGCCACGTTGGACCATGTGGCT
GCCCAACAGGCTCCCATTAAACTGGTGAATTTGGACGATTCGGAGTCGCTGGTGCTGGATGCCATCAAGCGTGGT
CATGGGGACCAAGACTTGGGGCCGCATCAAGGCTTGCCTGTCAACAAGGGTCGAAGCGTCATTTTGCGCATCTAC
GAGTCTCTTGGAGGCCACAGCCGAGGCGAGATTCAGACGCAGTTTGACGTTAGGCGCGTGGTCAAGACGAATGTG
CTTGAGGATGAAGTAGAGGAAGTCAAGTTTGATGCAGGCAAGTTCTCCATCAGGCTTCGCCCGTTTGAGGTTGCC
ACGTTTAAGCTTGAGCTCTAG
Transcript >OphauB2|1696
ATGGGTGGTGGCGGTGATGTCGGGACTGAAAAGTCCTCGTTCCCCGTCTTTGCTCACAGGCCCGTAGGCGTGCCC
AAGACGAGCATTCTCAAGCAGCGCATTGAGCTCTTCTACAGATCGACCCAGTATGAGAGGGTCAATCTGCTGGCA
AAGCTCTACAATGGCAGAGTCTCGGGAAAGCCTCATGTCAAACTCTACGTCTGGAGCGCCCCAGGACAGGAGCGC
CCCAGCTTCAATGATGCTGTTTCTCATGAGTTCAAGGAGACGCGGACTGGCGCCTCGTTTGGCCCGTCATGGACG
ACGCACTGGTTCAGACTTCATCTGACGGTGCCCAAGGAGATGATGAAGGAGGAGCTTGTTGTGCTCGAATGGGAT
GCGAACAACGAGGCCATGGTGTGGTCGCACGACGGCATGCCTCTGCAGGGCCTCACAGGCGGCGACGAGCGCATT
GAATGGATCATTCCCAAGGCGATGCGCGACGGCAAGGAACACGTCATCTACATTGAGATGGCGTGCAACGGCATG
TTTGGCAATGCCCCCAGCGGCAGACCTAGTATCGCTCCGCCTGCCCCAGACAGGTACTTTAGCCTCAGCAAAGCC
AATATTGCCGCTCCCAATGTGCCTGCCCGCGCCCTCTACTTTGACATGTGGGAGCTTGGCGATGCCGCTCGCGAG
CTTCCAGAGGACTCGGCAGAGGAGACCAAGGCTCTGGCCGTGGCCATGGAAATCATTGACACGTTTCAAGTTGAC
AATCAAGAGTCTATTCTCCAATGCCGCCGTCTTGCCCAGCAAATCATCGGACCCGATGTCGACTCGCACCGCGTC
TACGACGTTGGCAAGGAGGGCACCGTCTTTGGTATTGGCCACTGTCACATTGATACGTGCTGGCTATGGCCATGG
GCTGAGACGAGACGCAAAGTCTGTCGCTCGTGGTCGAGCCAGTGCGACCTCATGGACCGCTATCCCGAGGCGCAT
TTTGCTTGCTCCCAGGCCCAGCAGTTCAAGTGGCTCAAGGAATACTATCCCAAAGCCTTTGAGCGTGTCAAGGCC
AAGGTCAAGGAGGGCCAGTTCCACCCCATTGGAGGCAGCTGGGTCGAGCACGACACCAATATGCCAAGCGGCGAA
TCCCTTGTCCGCCAGTTCTTCTATGGCCAGAGGTTCTTTGAGTCCGAGTTTGGCTCGCGCTGCCGCACTTTCTGG
CTGCCTGACACGTTTGGCTACACGAGCCAGCTGCCGCAGCTCTGCCGCCTGGCCGGCATGGACCGCTTCATGACG
CAGAAGCTCAGCTGGAACAACATCAACAACTTTCCTCACACGACATTTATGTGGGTGAGCCCCGACGGCAGCCAA
GTCATTTGCCACATGCCGCCCTCGGAGACTTACACATCCGACGCCGACTTTGGCGACGTGAGGCGCAGCATCACA
CAACACAAGACGATGCGAGTGGATAGCTCGTCGCTGCTCGTCTATGGCAAAGGCGACGGTGGCGGCGGCCCTACC
TGGGAGCATTTTGAAAAGCTTCGCCGCTGCGCCGGCATCAGCAACACAATTGGTGGCATTCCAAAGCTCAAGCTC
GGCCTCACGGTTGATGAGTTTTTTGACCGTCTGGCTCCCAAGGCCAACGACTTCCCTACCTGGGTTGGAGAGCTT
TACTTTGAGCTTCACCGCGGCACCTATACAACTCAGGCCAACAATAAGCTCTTCAACCGCAAGGCCGAGGTGATG
CTCCGTGACATTGAGCAGCTGGCCACGTTTGCCTCGATCAAATCCAAAGACTACAAGTATCCGTCGGCCGACATT
GACGAAATGTGGCAAGCCGTCTTGCTCTGCCAGTTCCACGACTGCCTTCCCGGAAGCTCTATTGAGATGTGCTAT
CAAGACTCAACCAAGCTCTATACCCAAGTCTTTGGCAAAGGCCAGAAACTGCTTGATGAATTGTATAAAATACTG
GGCACCTCGACTGAGCACCCGCAGTCTTTGCGCGCAACAGTTGCCGCCAATACACTGCCCTGGCATCGCCATGAG
CTCGTTGAAGTCTCTGAGACGGAAGTGGGAGTAGCCTGTGGTGGCGGCCAGCTGCTTCCTGTGCATGCTTTTACG
CCCAAGGACGACGGCCCAGCAGTAACTGTGACGCAAAAGGGTAACGACTTTATACTGGAGAGCGACCATTTGCGC
CTTGTTGTAAAGGAAGGCTGCATCTCGTCTCTGTATGACCGTGTCAACGACCACGAGGTGGTTGAAGCAGGCGCC
CAGGCCAACAAGTTTGTCCTGTTTGACGACATTCCTCTGTATTGGGAGGCTTGGGATGTCGAGGTCTATCACCTC
GAGACGCGCAGAGAGGTGGAGTACGGCACGACGGCAATTCATGAAAAGAAAGCCCACAAAGTGACGCTGGTTACC
GACATCAAAATTAGCCACGAGAGCTCCCTCAAGTCATACATCACCCTTTGGGCAGCCATCAAGGACCAGCCGTCG
AGGGTGGATTGCTCTGCCGAGGTGGATTGGCACGAGAACTCCAAGTTCCTCAAGGTTGAGTTTCCTGTCAATGTG
GTGAGCCCGGATGCCTCGTATGAGTCGGCCTATAGCATCACGAAGCGACCGACGCATTACAATACCAGTTGGGAC
ATGGCCAAGTTTGAGGTGTGCTGCCACAAGTTTGCCGATTTATCCGAGCACAACTATGGCGTCTCTATTCTCAAT
GACAGCAAGTATGGCTTCGCCACGGCGGGCAAGACGATGCGCCTGTCACTTCTGCGCTCTCCCAAGGCACCAGAC
GGCAACGCCGACATGGGCCACCATTCAATTCGCTGGGCCATTTTCCCCCACCGAGGCTCTCTATCGTCGGCCACG
GTCAAGGCGGCCTATGCCTTCAACAACCCCCTCAAGTTGCTTTCGGCGTCGCAGGCCACGTTGGACCATGTGGCT
GCCCAACAGGCTCCCATTAAACTGGTGAATTTGGACGATTCGGAGTCGCTGGTGCTGGATGCCATCAAGCGTGGT
CATGGGGACCAAGACTTGGGGCCGCATCAAGGCTTGCCTGTCAACAAGGGTCGAAGCGTCATTTTGCGCATCTAC
GAGTCTCTTGGAGGCCACAGCCGAGGCGAGATTCAGACGCAGTTTGACGTTAGGCGCGTGGTCAAGACGAATGTG
CTTGAGGATGAAGTAGAGGAAGTCAAGTTTGATGCAGGCAAGTTCTCCATCAGGCTTCGCCCGTTTGAGGTTGCC
ACGTTTAAGCTTGAGCTCTAG
Gene >OphauB2|1696
ATGGGTGGTGGCGGTGATGTCGGGACTGAAAAGTCCTCGTTCCCCGTCTTTGCTCACAGGCCCGTAGGCGTGCCC
AAGACGAGCATTCTCAAGCAGCGCATTGAGCTCTTCTACAGATCGACCCAGTATGAGAGGGTCAATCTGCTGGCG
TAGGTGGTGCTGCTGGCCTGGTGCCCTTTTTGCTTGCTGACTGGCGGATAGAAAGCTCTACAATGGCAGAGTCTC
GGGAAAGCCTCATGTCAAACTCTACGTCTGGAGCGCCCCAGGACAGGAGCGCCCCAGCTTCAATGATGCTGTTTC
TCATGAGTTCAAGGAGACGCGGACTGGCGCCTCGTTTGGCCCGTCATGGACGACGCACTGGTTCAGACTTCATCT
GACGGTGCCCAAGGAGATGATGAAGGAGGAGCTTGTTGTGCTCGAATGGGATGCGAACAACGAGGCCATGGTGTG
GTCGCACGACGGCATGCCTCTGCAGGGCCTCACAGGCGGCGACGAGCGCATTGAATGGATCATTCCCAAGGCGAT
GCGCGACGGCAAGGAACACGTCATCTACATTGAGATGGCGTGCAACGGCATGTTTGGCAATGCCCCCAGCGGCAG
ACCTAGTATCGCTCCGCCTGCCCCAGACAGGTACTTTAGCCTCAGCAAAGCCAATATTGCCGCTCCCAATGTGCC
TGCCCGCGCCCTCTACTTTGACATGTGGGAGCTTGGCGATGCCGCTCGCGAGCTTCCAGAGGACTCGGCAGAGGA
GACCAAGGCTCTGGCCGTGGCCATGGAAATCATTGACACGTTTCAAGTTGACAATCAAGAGTCTATTCTCCAATG
CCGCCGTCTTGCCCAGCAAATCATCGGACCCGATGTCGACTCGCACCGCGTCTACGACGTTGGCAAGGAGGGCAC
CGTCTTTGGTATTGGCCACTGTCACATTGATACGTGCTGGCTATGGCCATGGGCTGAGACGAGACGCAAAGTCTG
TCGCTCGTGGTCGAGCCAGTGCGACCTCATGGACCGCTATCCCGAGGCGCATTTTGCTTGCTCCCAGGCCCAGCA
GTTCAAGTGGCTCAAGGAATACTATCCCAAAGCCTTTGAGCGTGTCAAGGCCAAGGTCAAGGAGGGCCAGTTCCA
CCCCATTGGAGGCAGCTGGGTCGAGCACGACACCAATATGCCAAGCGGCGAATCCCTTGTCCGCCAGTTCTTCTA
TGGCCAGAGGTTCTTTGAGTCCGAGTTTGGCTCGCGCTGCCGCACTTTCTGGCTGCCTGACACGTTTGGCTACAC
GAGCCAGCTGCCGCAGCTCTGCCGCCTGGCCGGCATGGACCGCTTCATGACGCAGAAGCTCAGCTGGAACAACAT
CAACAACTTTCCTCACACGACATTTATGTGGGTGAGCCCCGACGGCAGCCAAGTCATTTGCCACATGCCGCCCTC
GGAGACTTACACATCCGACGCCGACTTTGGCGACGTGAGGCGCAGCATCACACAACACAAGACGATGCGAGTGGA
TAGCTCGTCGCTGCTCGTCTATGGCAAAGGCGACGGTGGCGGCGGCCCTACCTGGGAGCATTTTGAAAAGCTTCG
CCGCTGCGCCGGCATCAGCAACACAATTGGTGGCATTCCAAAGCTCAAGCTCGGCCTCACGGTTGATGAGTTTTT
TGACCGTCTGGCTCCCAAGGCCAACGACTTCCCTACCTGGGTTGGAGAGCTTTACTTTGAGCTTCACCGCGGCAC
CTATACAACTCAGGCCAACAATAAGCTCTTCAACCGCAAGGCCGAGGTGATGCTCCGTGACATTGAGCAGCTGGC
CACGTTTGCCTCGATCAAATCCAAAGACTACAAGTATCCGTCGGCCGACATTGACGAAATGTGGCAAGCCGTCTT
GCTCTGCCAGTTCCACGACTGCCTTCCCGGAAGCTCTATTGAGATGTGCTATCAAGACTCAACCAAGGTGGGCCG
TCTGTCTATGAGATTGACTTGGCTGCCCTGTGCTAATTGTTGCCTAGCTCTATACCCAAGTCTTTGGCAAAGGCC
AGAAACTGCTTGATGAATTGTATAAAATACTGGGCACCTCGACTGAGCACCCGCAGTCTTTGCGCGCAACAGTTG
CCGCCAATACACTGCCCTGGCATCGCCATGAGCTCGTTGAAGTCTCTGAGACGGAAGTGGGAGTAGCCTGTGGTG
GCGGCCAGCTGCTTCCTGTGCATGCTTTTACGCCCAAGGACGACGGCCCAGCAGTAACTGTGACGCAAAAGGGTA
ACGACTTTATACTGGAGAGCGACCATTTGCGCCTTGTTGTAAAGGAAGGCTGCATCTCGTCTCTGTATGACCGTG
TCAACGACCACGAGGTGGTTGAAGCAGGCGCCCAGGCCAACAAGTTTGTCCTGTTTGACGACATTCCTCTGTATT
GGGAGGCTTGGGATGTCGAGGTCTATCACCTCGAGACGCGCAGAGAGGTGGAGTACGGCACGACGGCAATTCATG
AAAAGAAAGCCCACAAAGTGACGCTGGTTACCGACATCAAAATTAGCCACGAGAGCTCCCTCAAGTCATACATCA
CCCTTTGGGCAGCCATCAAGGACCAGCCGTCGAGGGTGGATTGCTCTGCCGAGGTGGATTGGCACGAGAACTCCA
AGTTCCTCAAGGTTGAGTTTCCTGTCAATGTGGTGAGCCCGGATGCCTCGTATGAGTCGGCCTATAGCATCACGA
AGCGACCGACGCATTACAATACCAGTTGGGACATGGCCAAGTTTGAGGTGTGCTGCCACAAGTTTGCCGATTTAT
CCGAGCACAACTATGGCGTCTCTATTCTCAATGACAGCAAGTATGGCTTCGCCACGGCGGGCAAGACGATGCGCC
TGTCACTTCTGCGCTCTCCCAAGGCACCAGACGGCAACGCCGACATGGGCCACCATTCAATTCGCTGGGCCATTT
TCCCCCACCGAGGCTCTCTATCGTCGGCCACGGTCAAGGCGGCCTATGCCTTCAACAACCCCCTCAAGTTGCTTT
CGGCGTCGCAGGCCACGTTGGACCATGTGGCTGCCCAACAGGCTCCCATTAAACTGGTGAATTTGGACGATTCGG
AGTCGCTGGTGCTGGATGCCATCAAGCGTGGTCATGGGGACCAAGACTTGGGGCCGCATCAAGGCTTGCCTGTCA
ACAAGGGTCGAAGCGTCATTTTGCGCATCTACGAGTCTCTTGGAGGCCACAGCCGAGGCGAGATTCAGACGCAGT
TTGACGTTAGGCGCGTGGTCAAGACGAATGTGCTTGAGGATGAAGTAGAGGAAGTCAAGTTTGATGCAGGCAAGT
TCTCCATCAGGCTTCGCCCGTTTGAGGTTGCCACGTTTAAGCTTGAGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail