Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1694
Gene name
LocationContig_148:43954..45023
Strand+
Gene length (bp)1069
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00466 Ribosomal_L10 Ribosomal protein L10 1.2E-21 5 100
PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P 1.9E-21 109 178
PF00428 Ribosomal_60s 60s Acidic ribosomal protein 1.0E-18 229 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96TJ5|RLA0_NEUCR 60S acidic ribosomal protein P0 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=p0 PE=2 SV=1 1 269 2.0E-159
sp|Q9C3Z6|RLA0_PODAS 60S acidic ribosomal protein P0 OS=Podospora anserina PE=3 SV=1 1 267 1.0E-157
sp|P05317|RLA0_YEAST 60S acidic ribosomal protein P0 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP0 PE=1 SV=2 1 314 2.0E-122
sp|O74864|RLA0_SCHPO 60S acidic ribosomal protein P0 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp0 PE=3 SV=1 1 314 3.0E-120
sp|Q9DG68|RLA0_RANSY 60S acidic ribosomal protein P0 OS=Rana sylvatica GN=RPLP0 PE=2 SV=1 8 273 3.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96TJ5|RLA0_NEUCR 60S acidic ribosomal protein P0 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=p0 PE=2 SV=1 1 269 2.0E-159
sp|Q9C3Z6|RLA0_PODAS 60S acidic ribosomal protein P0 OS=Podospora anserina PE=3 SV=1 1 267 1.0E-157
sp|P05317|RLA0_YEAST 60S acidic ribosomal protein P0 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP0 PE=1 SV=2 1 314 2.0E-122
sp|O74864|RLA0_SCHPO 60S acidic ribosomal protein P0 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp0 PE=3 SV=1 1 314 3.0E-120
sp|Q9DG68|RLA0_RANSY 60S acidic ribosomal protein P0 OS=Rana sylvatica GN=RPLP0 PE=2 SV=1 8 273 3.0E-103
sp|Q93572|RLA0_CAEEL 60S acidic ribosomal protein P0 OS=Caenorhabditis elegans GN=rpa-0 PE=1 SV=3 4 314 1.0E-98
sp|Q9U3U0|RLA0_CERCA 60S acidic ribosomal protein P0 OS=Ceratitis capitata GN=RpLP0 PE=3 SV=1 4 273 4.0E-98
sp|P47826|RLA0_CHICK 60S acidic ribosomal protein P0 OS=Gallus gallus GN=RPLP0 PE=2 SV=1 8 270 1.0E-96
sp|P19889|RLA0_DROME 60S acidic ribosomal protein P0 OS=Drosophila melanogaster GN=RpLP0 PE=1 SV=1 4 273 1.0E-96
sp|P05388|RLA0_HUMAN 60S acidic ribosomal protein P0 OS=Homo sapiens GN=RPLP0 PE=1 SV=1 8 273 5.0E-96
sp|Q95140|RLA0_BOVIN 60S acidic ribosomal protein P0 OS=Bos taurus GN=RPLP0 PE=2 SV=3 8 273 5.0E-96
sp|Q29214|RLA0_PIG 60S acidic ribosomal protein P0 OS=Sus scrofa GN=RPLP0 PE=1 SV=2 8 273 6.0E-96
sp|Q90YX1|RLA0_ICTPU 60S acidic ribosomal protein P0 OS=Ictalurus punctatus GN=rplp0 PE=2 SV=1 8 273 4.0E-95
sp|Q9PV90|RLA0_DANRE 60S acidic ribosomal protein P0 OS=Danio rerio GN=rplp0 PE=2 SV=1 8 314 7.0E-95
sp|P14869|RLA0_MOUSE 60S acidic ribosomal protein P0 OS=Mus musculus GN=Rplp0 PE=1 SV=3 8 273 1.0E-94
sp|P19945|RLA0_RAT 60S acidic ribosomal protein P0 OS=Rattus norvegicus GN=Rplp0 PE=1 SV=2 8 264 1.0E-92
sp|Q8NHW5|RLA0L_HUMAN 60S acidic ribosomal protein P0-like OS=Homo sapiens GN=RPLP0P6 PE=5 SV=1 8 270 4.0E-91
sp|P50346|RLA0_SOYBN 60S acidic ribosomal protein P0 OS=Glycine max PE=2 SV=1 4 273 2.0E-89
sp|P41095|RLA0_ORYSJ 60S acidic ribosomal protein P0 OS=Oryza sativa subsp. japonica GN=Os08g0130500 PE=1 SV=3 4 287 3.0E-88
sp|P57691|RLA03_ARATH 60S acidic ribosomal protein P0-3 OS=Arabidopsis thaliana GN=RPP0C PE=1 SV=1 4 273 3.0E-85
sp|O04204|RLA01_ARATH 60S acidic ribosomal protein P0-1 OS=Arabidopsis thaliana GN=RPP0A PE=1 SV=1 4 283 3.0E-85
sp|Q42112|RLA02_ARATH 60S acidic ribosomal protein P0-2 OS=Arabidopsis thaliana GN=RPP0B PE=1 SV=2 4 273 3.0E-85
sp|O24573|RLA0_MAIZE 60S acidic ribosomal protein P0 OS=Zea mays GN=RP-P0 PE=1 SV=3 4 279 2.0E-84
sp|P50345|RLA0_LUPLU 60S acidic ribosomal protein P0 OS=Lupinus luteus PE=2 SV=1 4 270 7.0E-74
sp|Q94660|RLA0_PLAF8 60S acidic ribosomal protein P0 OS=Plasmodium falciparum (isolate 7G8) GN=RPLP0 PE=2 SV=2 4 271 2.0E-73
sp|P29764|RLA0_OXYRB 60S acidic ribosomal protein P0 OS=Oxybasis rubra PE=2 SV=1 4 238 5.0E-70
sp|P22685|RLA0_DICDI 60S acidic ribosomal protein P0 OS=Dictyostelium discoideum GN=rplp0 PE=1 SV=2 2 264 3.0E-66
sp|Q967Y7|RLA0_EIMTE 60S acidic ribosomal protein P0 OS=Eimeria tenella PE=2 SV=1 5 269 6.0E-64
sp|P26796|RLA0_TRYCR 60S acidic ribosomal protein P0 OS=Trypanosoma cruzi PE=2 SV=2 5 261 3.0E-60
sp|P39096|RLA0_LEICH 60S acidic ribosomal protein P0 OS=Leishmania chagasi GN=LCP0 PE=3 SV=1 8 259 5.0E-54
sp|Q8SRJ7|RLA0_ENCCU 60S acidic ribosomal protein P0 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPP0 PE=1 SV=2 12 259 1.0E-53
sp|P39097|RLA0_LEIIN 60S acidic ribosomal protein P0 OS=Leishmania infantum GN=LIPO-A PE=3 SV=1 8 259 1.0E-50
sp|P15826|RL10_METVS 50S ribosomal protein L10 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl10 PE=1 SV=2 15 255 4.0E-32
sp|B6YSX9|RL10_THEON 50S ribosomal protein L10 OS=Thermococcus onnurineus (strain NA1) GN=rpl10 PE=3 SV=1 12 262 1.0E-30
sp|Q8TX50|RL10_METKA 50S ribosomal protein L10 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl10 PE=3 SV=2 14 259 2.0E-30
sp|Q8TZJ8|RL10_PYRFU 50S ribosomal protein L10 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl10 PE=1 SV=1 13 255 2.0E-30
sp|O74109|RL10_PYRHO 50S ribosomal protein L10 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl10 PE=1 SV=1 13 255 2.0E-30
sp|Q5JH36|RL10_THEKO 50S ribosomal protein L10 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl10 PE=3 SV=1 13 255 6.0E-30
sp|Q6M0L1|RL10_METMP 50S ribosomal protein L10 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl10 PE=1 SV=1 15 255 9.0E-30
sp|Q9UXS5|RL10_PYRAB 50S ribosomal protein L10 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl10 PE=3 SV=1 13 255 1.0E-29
sp|A4FZS8|RL10_METM5 50S ribosomal protein L10 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl10 PE=3 SV=1 15 255 8.0E-29
sp|A5UKU8|RL10_METS3 50S ribosomal protein L10 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl10 PE=3 SV=1 12 285 8.0E-29
sp|O52705|RL10_METTL 50S ribosomal protein L10 OS=Methanothermococcus thermolithotrophicus GN=rpl10 PE=3 SV=1 13 255 3.0E-28
sp|A9A838|RL10_METM6 50S ribosomal protein L10 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl10 PE=3 SV=1 15 255 3.0E-28
sp|P13553|RL10_HALSA 50S ribosomal protein L10 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl10 PE=3 SV=1 14 260 7.0E-28
sp|B0R4W1|RL10_HALS3 50S ribosomal protein L10 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl10 PE=3 SV=1 14 260 7.0E-28
sp|A6UTF8|RL10_META3 50S ribosomal protein L10 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl10 PE=3 SV=1 13 255 2.0E-27
sp|Q9Y8J3|RL10_METVO 50S ribosomal protein L10 (Fragment) OS=Methanococcus voltae GN=rpl10 PE=3 SV=1 8 252 8.0E-27
sp|C5A428|RL10_THEGJ 50S ribosomal protein L10 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl10 PE=3 SV=1 13 262 1.0E-26
sp|Q3INI7|RL10_NATPD 50S ribosomal protein L10 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl10 PE=3 SV=1 8 260 1.0E-26
sp|A6VIP9|RL10_METM7 50S ribosomal protein L10 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl10 PE=3 SV=1 15 255 2.0E-26
sp|P15825|RL10_HALMA 50S ribosomal protein L10 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl10 PE=1 SV=2 8 260 4.0E-26
sp|P41198|RL10_HALVD 50S ribosomal protein L10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rpl10 PE=3 SV=2 13 259 8.0E-26
sp|O27717|RL10_METTH 50S ribosomal protein L10 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl10 PE=3 SV=1 14 237 1.0E-25
sp|C6A1F5|RL10_THESM 50S ribosomal protein L10 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl10 PE=3 SV=1 13 255 2.0E-24
sp|P54049|RL10_METJA 50S ribosomal protein L10 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl10 PE=1 SV=2 15 255 2.0E-24
sp|Q2NEW2|RL10_METST 50S ribosomal protein L10 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl10 PE=3 SV=1 14 238 5.0E-24
sp|Q971J2|RL10_SULTO 50S ribosomal protein L10 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl10 PE=3 SV=2 14 277 9.0E-24
sp|Q6L1X8|RL10_PICTO 50S ribosomal protein L10 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl10 PE=3 SV=1 8 255 1.0E-22
sp|Q8PY51|RL10_METMA 50S ribosomal protein L10 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl10 PE=3 SV=1 8 251 1.0E-21
sp|Q46EU9|RL10_METBF 50S ribosomal protein L10 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl10 PE=1 SV=1 18 235 4.0E-21
sp|P96039|RL10_SULSO 50S ribosomal protein L10 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl10 PE=3 SV=2 14 276 6.0E-21
sp|Q8ZTT3|RL10_PYRAE 50S ribosomal protein L10 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl10 PE=3 SV=1 6 250 6.0E-21
sp|C3MZC0|RL10_SULIA 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain M.16.27) GN=rpl10 PE=3 SV=1 15 276 9.0E-21
sp|C3MR85|RL10_SULIL 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl10 PE=3 SV=1 15 276 2.0E-20
sp|C3NG93|RL10_SULIN 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl10 PE=3 SV=1 15 276 2.0E-20
sp|C3N7E1|RL10_SULIY 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl10 PE=3 SV=1 15 276 2.0E-20
sp|P35023|RL10_SULAC 50S ribosomal protein L10 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl10 PE=3 SV=1 19 277 3.0E-20
sp|C3MXH4|RL10_SULIM 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl10 PE=3 SV=1 15 276 7.0E-20
sp|C4KIJ9|RL10_SULIK 50S ribosomal protein L10 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl10 PE=3 SV=1 15 276 7.0E-20
sp|Q8TI80|RL10_METAC 50S ribosomal protein L10 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl10 PE=3 SV=1 8 251 3.0E-19
sp|Q12UP8|RL10_METBU 50S ribosomal protein L10 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl10 PE=3 SV=1 8 263 8.0E-19
sp|A8ABQ7|RL10_IGNH4 50S ribosomal protein L10 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl10 PE=3 SV=1 8 255 9.0E-19
sp|A3DNI2|RL10_STAMF 50S ribosomal protein L10 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl10 PE=3 SV=1 15 277 2.0E-17
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 7 208 9.0E-15
sp|O28781|RL10_ARCFU 50S ribosomal protein L10 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl10 PE=3 SV=1 2 228 4.0E-14
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 7 179 2.0E-11
sp|Q75DK9|MRT4_ASHGO Ribosome assembly factor mrt4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRT4 PE=3 SV=1 7 192 2.0E-11
sp|Q97BN3|RL10_THEVO 50S ribosomal protein L10 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl10 PE=3 SV=1 23 313 4.0E-11
sp|P33201|MRT4_YEAST Ribosome assembly factor MRT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRT4 PE=1 SV=1 7 192 3.0E-10
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 8 124 4.0E-10
sp|P57692|RL10_THEAC 50S ribosomal protein L10 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl10 PE=3 SV=1 5 209 7.0E-10
sp|Q86HD3|MRT4_DICDI Ribosome assembly factor mrt4 OS=Dictyostelium discoideum GN=mrt4 PE=3 SV=1 15 185 7.0E-10
sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein 4 homolog OS=Homo sapiens GN=MRTO4 PE=1 SV=2 8 192 5.0E-09
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 8 193 1.0E-08
sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus GN=MRTO4 PE=2 SV=1 8 192 2.0E-08
sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus GN=Mrto4 PE=1 SV=1 8 192 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1694
MGGKSANKAGYFDKLKGLLEEYKSIFVVTIDNVSSQQMHEIRHGLRGEGVVLMGKNTMVRRALRTFITDTPEYEK
LLPYVKGNVGFVFTNKDLKSVRDKLLSNRVAAPARAGALAPIDVWVPAGNTGMEPGKTSFFQALQVPTKIARGTI
EITTDLKLVEAGTKVGPSEATLLNMLNISPFTYGMGIAQVYDQGQTFPAEILDIGDEQLLGALSKCITTIASVSL
AINYPTMASVMHSLVNTYKKALSVAIETDYSWPEIEELKDRIANPEAYAAAAPAAAAGGASAAADSKPAEEKKDE
SEEEDDEGFGGLFD*
Coding >OphauB2|1694
ATGGGGGGCAAGTCTGCAAACAAGGCTGGCTACTTCGACAAGCTCAAGGGCTTGTTGGAGGAGTACAAGTCCATC
TTCGTCGTCACCATTGATAATGTCTCGTCGCAGCAGATGCACGAGATTCGTCATGGCCTTCGCGGAGAAGGCGTC
GTTTTGATGGGAAAGAACACCATGGTTCGTCGCGCCCTCAGAACCTTCATCACCGATACTCCCGAGTACGAGAAA
CTTCTGCCCTATGTCAAGGGCAACGTTGGCTTCGTCTTCACCAACAAGGACCTCAAATCTGTTCGTGACAAGCTA
TTGTCAAACCGCGTTGCTGCTCCTGCCCGTGCTGGCGCCCTCGCTCCCATCGATGTTTGGGTCCCCGCCGGAAAC
ACTGGCATGGAGCCCGGCAAGACGTCCTTTTTCCAGGCCCTTCAGGTGCCCACCAAGATTGCCCGTGGCACCATT
GAAATCACGACGGATCTGAAGCTTGTCGAGGCCGGCACCAAGGTCGGCCCCTCAGAGGCTACCTTGCTCAACATG
CTCAACATCTCGCCTTTTACCTATGGTATGGGCATCGCTCAGGTCTACGACCAGGGCCAAACCTTCCCGGCCGAG
ATTCTCGATATTGGTGACGAGCAGCTGCTCGGCGCCCTGTCCAAGTGTATCACTACCATTGCCTCCGTCTCCCTC
GCCATCAATTACCCGACAATGGCCTCTGTCATGCACTCTCTTGTCAACACTTACAAGAAAGCTCTTTCAGTTGCC
ATTGAGACGGACTACAGCTGGCCTGAAATTGAGGAACTCAAGGACCGCATCGCCAATCCCGAGGCTTATGCAGCT
GCTGCTCCTGCGGCTGCTGCTGGAGGTGCCAGTGCCGCCGCAGACTCCAAGCCTGCCGAGGAGAAGAAGGATGAA
TCTGAGGAGGAGGATGACGAAGGTTTTGGTGGCCTCTTTGACTAA
Transcript >OphauB2|1694
ATGGGGGGCAAGTCTGCAAACAAGGCTGGCTACTTCGACAAGCTCAAGGGCTTGTTGGAGGAGTACAAGTCCATC
TTCGTCGTCACCATTGATAATGTCTCGTCGCAGCAGATGCACGAGATTCGTCATGGCCTTCGCGGAGAAGGCGTC
GTTTTGATGGGAAAGAACACCATGGTTCGTCGCGCCCTCAGAACCTTCATCACCGATACTCCCGAGTACGAGAAA
CTTCTGCCCTATGTCAAGGGCAACGTTGGCTTCGTCTTCACCAACAAGGACCTCAAATCTGTTCGTGACAAGCTA
TTGTCAAACCGCGTTGCTGCTCCTGCCCGTGCTGGCGCCCTCGCTCCCATCGATGTTTGGGTCCCCGCCGGAAAC
ACTGGCATGGAGCCCGGCAAGACGTCCTTTTTCCAGGCCCTTCAGGTGCCCACCAAGATTGCCCGTGGCACCATT
GAAATCACGACGGATCTGAAGCTTGTCGAGGCCGGCACCAAGGTCGGCCCCTCAGAGGCTACCTTGCTCAACATG
CTCAACATCTCGCCTTTTACCTATGGTATGGGCATCGCTCAGGTCTACGACCAGGGCCAAACCTTCCCGGCCGAG
ATTCTCGATATTGGTGACGAGCAGCTGCTCGGCGCCCTGTCCAAGTGTATCACTACCATTGCCTCCGTCTCCCTC
GCCATCAATTACCCGACAATGGCCTCTGTCATGCACTCTCTTGTCAACACTTACAAGAAAGCTCTTTCAGTTGCC
ATTGAGACGGACTACAGCTGGCCTGAAATTGAGGAACTCAAGGACCGCATCGCCAATCCCGAGGCTTATGCAGCT
GCTGCTCCTGCGGCTGCTGCTGGAGGTGCCAGTGCCGCCGCAGACTCCAAGCCTGCCGAGGAGAAGAAGGATGAA
TCTGAGGAGGAGGATGACGAAGGTTTTGGTGGCCTCTTTGACTAA
Gene >OphauB2|1694
ATGGGGGGCAAGTCTGCAAACAAGGCTGGCTACTTCGACAAGCTCAAGGGCTTGTTGGAGGAGTACAAGTCCATC
TTCGTCGTCACCATTGATAATGTCTCGTCGCAGCAGATGCACGAGATTCGTCATGGCCTTCGCGGAGAAGGCGTC
GTTTTGATGGGAAAGAACACCATGGTAATGCCCCCCCCCCCAAAAAAAAGGCGTCACGGTTGTCAAGAGCCAGCC
CTAACTTGCTGCCCTAGGTTCGTCGCGCCCTCAGAACCTTCATCACCGATACTCCCGAGTACGAGAAACTTCTGC
CCTATGTCAAGGGCAACGTTGGCTTCGTCTTCACCAACAAGGACCTCAAATCTGTTCGTGACAAGCTATTGTCAA
ACCGCGTTGCTGCTCCTGCCCGTGCTGGCGCCCTCGCTCCCATCGATGTTTGGGTCCCCGCCGGAAACACTGGCA
TGGAGCCCGGCAAGACGTCCTTTTTCCAGGCCCTTCAGGTGCCCACCAAGATTGCCCGTGGCACCATTGAAATCA
CGACGGATCTGAAGCTTGTCGAGGCCGGCACCAAGGTCGGCCCCTCAGAGGCTACCTTGCTCAACATGCTCAACA
TCTCGCCTTTTACCTATGGTATGGGCATCGCTCAGGTCTACGACCAGGGCCAAACCTTCCCGGCCGAGATTCTCG
ATATTGGTGACGAGCAGCTGCTCGGCGCCCTGTCCAAGTGTATCACTACCATTGCCTCCGTCTCCCTCGCCATCA
ATTACCCGACAATGGCCTCTGTCATGCACTCTCTTGTCAACACTTACAAGAAAGCTCTTTCAGTTGCCATTGAGA
CGGACTACAGCTGGCCTGAAATTGAGGAACTCAAGGACCGCATCGCCAATCCCGAGGCTTATGCAGCTGCTGCTC
CTGCGGCTGCTGCTGGAGGTGCCAGTGCCGCCGCAGACTCCAAGCCTGCCGAGGAGAAGAAGGATGAATCTGAGG
AGGAGGATGACGAAGGTTTTGGTGGCCTCTTGTATGTTGCGACGTCCCCTTTCGCCTGCTTGACTCATGAGCTAA
TTGTCTCCACAGTGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail