Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1691
Gene name
LocationContig_148:35009..37598
Strand+
Gene length (bp)2589
Transcript length (bp)2517
Coding sequence length (bp)2517
Protein length (aa) 839

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01302 CAP_GLY CAP-Gly domain 5.2E-16 125 192
PF16641 CLIP1_ZNF CLIP1 zinc knuckle 3.3E-03 722 737
PF16641 CLIP1_ZNF CLIP1 zinc knuckle 6.3E-04 817 832

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P79065|TIP1_SCHPO Tip elongation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tip1 PE=1 SV=1 125 196 6.0E-12
sp|P34531|YM92_CAEEL Uncharacterized protein M01A8.2 OS=Caenorhabditis elegans GN=M01A8.2 PE=3 SV=4 121 197 8.0E-10
sp|P11709|BIK1_YEAST Nuclear fusion protein BIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIK1 PE=1 SV=1 125 207 2.0E-09
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 65 207 1.0E-08
sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster GN=CLIP-190 PE=1 SV=1 100 201 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P79065|TIP1_SCHPO Tip elongation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tip1 PE=1 SV=1 125 196 6.0E-12
sp|P34531|YM92_CAEEL Uncharacterized protein M01A8.2 OS=Caenorhabditis elegans GN=M01A8.2 PE=3 SV=4 121 197 8.0E-10
sp|P11709|BIK1_YEAST Nuclear fusion protein BIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIK1 PE=1 SV=1 125 207 2.0E-09
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 65 207 1.0E-08
sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster GN=CLIP-190 PE=1 SV=1 100 201 3.0E-08
sp|P35458|DCTN1_CHICK Dynactin subunit 1 OS=Gallus gallus GN=DCTN1 PE=1 SV=2 123 592 4.0E-08
sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 122 207 9.0E-08
sp|O08788|DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus GN=Dctn1 PE=1 SV=3 125 592 1.0E-07
sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 122 202 1.0E-07
sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 111 234 8.0E-07
sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus GN=Clip2 PE=1 SV=2 95 207 2.0E-06
sp|P28023|DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus GN=Dctn1 PE=1 SV=2 125 592 3.0E-06
sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus GN=Clip2 PE=1 SV=1 95 207 3.0E-06
sp|Q9UDT6|CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens GN=CLIP2 PE=1 SV=1 95 207 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1691
MAPTATAIATAITTSQHHYNNTNNNTTTTTANRPPPASFARSLRSSKLTASTPDLGASYLSHSRLAPPGLSRKTS
LAALTSSTLASIPDVSESYALDSVLSVSDPDSSIMSPVTPSRQSFHDVAVGSAVDVPGGMHGVVRFLGPVQGKKG
IFAGIELHSSFASRGKNSGDVDGLTYFTTSTPGAGIFVPVAKISCRASPSASASTAQPMTPTSHVSAGLKNGGGT
ALSFTPPNPGFSKLSASVGPGARASSPQGKRPRTSLPRPDSPVRRTQMTPGPRPSLGNPTKTAPRYGSPTNRLAQ
SVRGTAGDPSKKQLRPERKPSLGPRSISALGSASAFDDETTPSTFQRAKTNGSVGSVSSFSLKLQRSPSRATTAN
TDEIERLRSQLEEKDRQLKEQGTALSEMESSLVELQSLIEHSDGPKPEQVSAQDNDVMQLRHLLREKNDRIASLT
AEFDAHRADFRSTIDTLEMASTETERVYERQIEELRNDMRELESRNLDVDSVASQLKQLEELVQELEEGLEDARR
GEAEARGEAEFLRGEVERTRSELRREREKSGKDTDETGNSAAAAASRELEQKEDEIRGLKTIIHSLSREAMPESG
TDSRPSALRSLTHSGTGETWSGKSTRDQMEHKVAELQAALEKKSLREGELELELEMLRGGSHSTQGSSVLAHHSS
QRDSRDTVVPMGSNYSRSPDTTHRRTKTLDTMPESDTVSTATESSTLWCEICETGGHDILTCTKMFGSEDAKSAI
ETPSVKGVDRRQGLKPRVAGVAHPAPLAPARAKTPVPTKAPAIKVLPNPMESGPVAGKESGIMDPEKWCAVCERD
GHDSVDCPFEEAF*
Coding >OphauB2|1691
ATGGCTCCCACCGCTACCGCAATAGCAACCGCCATCACCACATCCCAGCACCACTATAACAACACTAACAACAAC
ACCACCACCACCACTGCCAATAGGCCCCCCCCTGCTTCGTTTGCGCGCTCTCTGCGCAGCTCCAAGCTGACGGCC
TCGACTCCTGACTTGGGTGCATCTTACCTCTCTCATTCCCGGCTTGCTCCCCCTGGCCTGTCGCGAAAAACATCC
CTCGCCGCCCTGACCTCATCGACGCTTGCAAGCATCCCCGATGTCAGCGAGAGCTACGCCCTTGACTCTGTTCTG
AGCGTCTCAGACCCCGACAGCTCAATCATGTCTCCTGTTACGCCTTCGCGGCAGTCTTTTCACGATGTAGCTGTT
GGTAGTGCTGTCGACGTCCCTGGAGGCATGCACGGCGTCGTACGCTTTCTCGGCCCTGTCCAGGGCAAAAAAGGC
ATCTTTGCTGGCATTGAGCTGCACTCGAGCTTTGCCTCGCGAGGCAAAAACAGCGGCGATGTTGACGGGCTCACT
TATTTCACTACTTCAACCCCTGGCGCTGGCATATTTGTCCCTGTTGCCAAGATTTCTTGCCGAGCCTCGCCTTCT
GCCTCAGCTTCAACCGCACAGCCAATGACTCCCACGTCCCACGTCTCCGCCGGCCTCAAGAACGGCGGAGGAACT
GCGCTCAGCTTCACGCCGCCTAACCCGGGCTTCTCCAAGCTTAGTGCTTCGGTCGGTCCCGGCGCCAGGGCCTCG
AGTCCTCAAGGAAAACGTCCCAGGACGTCGCTGCCTCGCCCCGACTCTCCTGTTCGTCGCACGCAAATGACACCC
GGCCCTCGGCCATCCTTGGGCAACCCAACAAAGACGGCCCCACGCTACGGGAGCCCTACAAATCGACTGGCTCAA
AGTGTTCGCGGCACTGCGGGGGATCCCAGCAAGAAACAGCTCAGACCTGAGCGCAAACCAAGTCTTGGACCTCGA
AGTATTTCGGCACTAGGGTCCGCCTCTGCCTTTGACGATGAGACAACTCCTTCCACTTTCCAGCGTGCAAAAACA
AATGGAAGTGTTGGGTCTGTTTCGTCTTTTAGTCTCAAGCTTCAACGTTCTCCATCGCGCGCTACCACTGCCAAT
ACCGACGAGATTGAACGCCTTCGTTCTCAGCTCGAGGAAAAGGACCGCCAGCTTAAAGAACAGGGCACAGCGCTT
TCCGAGATGGAAAGTAGTCTTGTCGAGCTTCAGTCTCTTATAGAGCACTCAGACGGTCCCAAGCCTGAACAAGTC
AGCGCCCAAGACAACGATGTGATGCAGCTACGACATTTGCTTCGAGAGAAAAACGACAGGATTGCTTCGCTAACT
GCAGAATTTGATGCTCATCGGGCAGACTTTCGGAGCACCATTGACACTCTTGAGATGGCCAGCACAGAAACGGAG
CGCGTATATGAAAGGCAGATTGAAGAGCTCAGAAACGATATGCGGGAACTCGAGTCTAGAAACCTTGACGTTGAC
TCTGTTGCAAGCCAGCTCAAGCAGCTAGAGGAGCTGGTCCAAGAACTCGAAGAGGGTCTTGAGGATGCTCGTCGC
GGCGAGGCAGAAGCTCGTGGCGAGGCCGAGTTTCTCCGAGGAGAGGTGGAGAGAACACGGTCGGAATTGCGTCGT
GAGCGAGAAAAAAGTGGCAAGGACACGGATGAAACAGGCAATTCTGCTGCAGCAGCTGCTTCTAGGGAGCTGGAG
CAGAAGGAAGATGAAATCCGCGGCCTCAAGACCATCATTCACTCGCTTAGTCGAGAAGCAATGCCGGAATCGGGC
ACAGACTCCCGTCCCTCGGCATTACGTTCACTGACGCACAGCGGTACTGGGGAGACTTGGAGTGGCAAGAGCACG
CGCGATCAAATGGAACACAAGGTTGCCGAGCTGCAGGCTGCCTTGGAGAAGAAGAGTCTACGTGAAGGAGAGCTT
GAACTGGAGCTCGAGATGCTACGCGGAGGGAGCCATAGCACCCAAGGCAGCTCGGTGCTAGCTCACCACTCGTCT
CAACGGGACTCGCGCGACACAGTGGTTCCCATGGGAAGCAACTACTCGCGGTCTCCCGACACGACGCACAGGCGA
ACAAAGACGCTCGACACAATGCCCGAAAGCGACACTGTGTCGACGGCCACAGAATCTAGCACCTTGTGGTGTGAG
ATTTGCGAGACTGGTGGTCACGACATCCTGACTTGCACCAAGATGTTTGGCTCCGAGGACGCAAAGAGCGCCATT
GAGACTCCATCTGTCAAGGGCGTGGACAGACGTCAAGGTCTCAAGCCTCGTGTAGCCGGTGTCGCTCATCCTGCG
CCTCTAGCTCCGGCCCGGGCAAAGACACCTGTGCCGACCAAGGCGCCTGCCATTAAGGTTCTTCCCAATCCCATG
GAGTCTGGGCCCGTTGCCGGCAAAGAGAGTGGCATCATGGATCCTGAGAAGTGGTGTGCTGTGTGTGAACGTGAT
GGCCACGACAGCGTCGACTGTCCATTTGAGGAGGCCTTTTAG
Transcript >OphauB2|1691
ATGGCTCCCACCGCTACCGCAATAGCAACCGCCATCACCACATCCCAGCACCACTATAACAACACTAACAACAAC
ACCACCACCACCACTGCCAATAGGCCCCCCCCTGCTTCGTTTGCGCGCTCTCTGCGCAGCTCCAAGCTGACGGCC
TCGACTCCTGACTTGGGTGCATCTTACCTCTCTCATTCCCGGCTTGCTCCCCCTGGCCTGTCGCGAAAAACATCC
CTCGCCGCCCTGACCTCATCGACGCTTGCAAGCATCCCCGATGTCAGCGAGAGCTACGCCCTTGACTCTGTTCTG
AGCGTCTCAGACCCCGACAGCTCAATCATGTCTCCTGTTACGCCTTCGCGGCAGTCTTTTCACGATGTAGCTGTT
GGTAGTGCTGTCGACGTCCCTGGAGGCATGCACGGCGTCGTACGCTTTCTCGGCCCTGTCCAGGGCAAAAAAGGC
ATCTTTGCTGGCATTGAGCTGCACTCGAGCTTTGCCTCGCGAGGCAAAAACAGCGGCGATGTTGACGGGCTCACT
TATTTCACTACTTCAACCCCTGGCGCTGGCATATTTGTCCCTGTTGCCAAGATTTCTTGCCGAGCCTCGCCTTCT
GCCTCAGCTTCAACCGCACAGCCAATGACTCCCACGTCCCACGTCTCCGCCGGCCTCAAGAACGGCGGAGGAACT
GCGCTCAGCTTCACGCCGCCTAACCCGGGCTTCTCCAAGCTTAGTGCTTCGGTCGGTCCCGGCGCCAGGGCCTCG
AGTCCTCAAGGAAAACGTCCCAGGACGTCGCTGCCTCGCCCCGACTCTCCTGTTCGTCGCACGCAAATGACACCC
GGCCCTCGGCCATCCTTGGGCAACCCAACAAAGACGGCCCCACGCTACGGGAGCCCTACAAATCGACTGGCTCAA
AGTGTTCGCGGCACTGCGGGGGATCCCAGCAAGAAACAGCTCAGACCTGAGCGCAAACCAAGTCTTGGACCTCGA
AGTATTTCGGCACTAGGGTCCGCCTCTGCCTTTGACGATGAGACAACTCCTTCCACTTTCCAGCGTGCAAAAACA
AATGGAAGTGTTGGGTCTGTTTCGTCTTTTAGTCTCAAGCTTCAACGTTCTCCATCGCGCGCTACCACTGCCAAT
ACCGACGAGATTGAACGCCTTCGTTCTCAGCTCGAGGAAAAGGACCGCCAGCTTAAAGAACAGGGCACAGCGCTT
TCCGAGATGGAAAGTAGTCTTGTCGAGCTTCAGTCTCTTATAGAGCACTCAGACGGTCCCAAGCCTGAACAAGTC
AGCGCCCAAGACAACGATGTGATGCAGCTACGACATTTGCTTCGAGAGAAAAACGACAGGATTGCTTCGCTAACT
GCAGAATTTGATGCTCATCGGGCAGACTTTCGGAGCACCATTGACACTCTTGAGATGGCCAGCACAGAAACGGAG
CGCGTATATGAAAGGCAGATTGAAGAGCTCAGAAACGATATGCGGGAACTCGAGTCTAGAAACCTTGACGTTGAC
TCTGTTGCAAGCCAGCTCAAGCAGCTAGAGGAGCTGGTCCAAGAACTCGAAGAGGGTCTTGAGGATGCTCGTCGC
GGCGAGGCAGAAGCTCGTGGCGAGGCCGAGTTTCTCCGAGGAGAGGTGGAGAGAACACGGTCGGAATTGCGTCGT
GAGCGAGAAAAAAGTGGCAAGGACACGGATGAAACAGGCAATTCTGCTGCAGCAGCTGCTTCTAGGGAGCTGGAG
CAGAAGGAAGATGAAATCCGCGGCCTCAAGACCATCATTCACTCGCTTAGTCGAGAAGCAATGCCGGAATCGGGC
ACAGACTCCCGTCCCTCGGCATTACGTTCACTGACGCACAGCGGTACTGGGGAGACTTGGAGTGGCAAGAGCACG
CGCGATCAAATGGAACACAAGGTTGCCGAGCTGCAGGCTGCCTTGGAGAAGAAGAGTCTACGTGAAGGAGAGCTT
GAACTGGAGCTCGAGATGCTACGCGGAGGGAGCCATAGCACCCAAGGCAGCTCGGTGCTAGCTCACCACTCGTCT
CAACGGGACTCGCGCGACACAGTGGTTCCCATGGGAAGCAACTACTCGCGGTCTCCCGACACGACGCACAGGCGA
ACAAAGACGCTCGACACAATGCCCGAAAGCGACACTGTGTCGACGGCCACAGAATCTAGCACCTTGTGGTGTGAG
ATTTGCGAGACTGGTGGTCACGACATCCTGACTTGCACCAAGATGTTTGGCTCCGAGGACGCAAAGAGCGCCATT
GAGACTCCATCTGTCAAGGGCGTGGACAGACGTCAAGGTCTCAAGCCTCGTGTAGCCGGTGTCGCTCATCCTGCG
CCTCTAGCTCCGGCCCGGGCAAAGACACCTGTGCCGACCAAGGCGCCTGCCATTAAGGTTCTTCCCAATCCCATG
GAGTCTGGGCCCGTTGCCGGCAAAGAGAGTGGCATCATGGATCCTGAGAAGTGGTGTGCTGTGTGTGAACGTGAT
GGCCACGACAGCGTCGACTGTCCATTTGAGGAGGCCTTTTAG
Gene >OphauB2|1691
ATGGCTCCCACCGCTACCGCAATAGCAACCGCCATCACCACATCCCAGCACCACTATAACAACACTAACAACAAC
ACCACCACCACCACTGCCAATAGGCCCCCCCCTGCTTCGTTTGCGCGCTCTCTGCGCAGCTCCAAGCTGACGGCC
TCGACTCCTGACTTGGGTGCATCTTACCTCTCTCATTCCCGGCTTGCTCCCCCTGGCCTGTCGCGAAAAACATCC
CTCGCCGCCCTGACCTCATCGACGCTTGCAAGCATCCCCGATGTCAGCGAGAGCTACGCCCTTGACTCTGTTCTG
AGCGTCTCAGACCCCGACAGCTCAATCATGTCTCCTGTTACGCCTTCGCGGCAGTCTTTTCACGATGTAGCTGTT
GGTAGTGCTGTCGACGTCCCTGGAGGCATGCACGGCGTCGTACGCTTTCTCGGCCCTGTCCAGGGCAAAAAAGGC
ATCTTTGCTGGCATTGAGCTGCACTCGAGCTTTGCCTCGCGAGGCAAAAACAGCGGCGATGTTGACGGGTATATG
ATCCTCTGCGCCGTTTGCACTCTCGTGAGACATGGCTAATATCTTTTCTTCTCCCTTGCTATCAGGCTCACTTAT
TTCACTACTTCAACCCCTGGCGCTGGCATATTTGTCCCTGTTGCCAAGATTTCTTGCCGAGCCTCGCCTTCTGCC
TCAGCTTCAACCGCACAGCCAATGACTCCCACGTCCCACGTCTCCGCCGGCCTCAAGAACGGCGGAGGAACTGCG
CTCAGCTTCACGCCGCCTAACCCGGGCTTCTCCAAGCTTAGTGCTTCGGTCGGTCCCGGCGCCAGGGCCTCGAGT
CCTCAAGGAAAACGTCCCAGGACGTCGCTGCCTCGCCCCGACTCTCCTGTTCGTCGCACGCAAATGACACCCGGC
CCTCGGCCATCCTTGGGCAACCCAACAAAGACGGCCCCACGCTACGGGAGCCCTACAAATCGACTGGCTCAAAGT
GTTCGCGGCACTGCGGGGGATCCCAGCAAGAAACAGCTCAGACCTGAGCGCAAACCAAGTCTTGGACCTCGAAGT
ATTTCGGCACTAGGGTCCGCCTCTGCCTTTGACGATGAGACAACTCCTTCCACTTTCCAGCGTGCAAAAACAAAT
GGAAGTGTTGGGTCTGTTTCGTCTTTTAGTCTCAAGCTTCAACGTTCTCCATCGCGCGCTACCACTGCCAATACC
GACGAGATTGAACGCCTTCGTTCTCAGCTCGAGGAAAAGGACCGCCAGCTTAAAGAACAGGGCACAGCGCTTTCC
GAGATGGAAAGTAGTCTTGTCGAGCTTCAGTCTCTTATAGAGCACTCAGACGGTCCCAAGCCTGAACAAGTCAGC
GCCCAAGACAACGATGTGATGCAGCTACGACATTTGCTTCGAGAGAAAAACGACAGGATTGCTTCGCTAACTGCA
GAATTTGATGCTCATCGGGCAGACTTTCGGAGCACCATTGACACTCTTGAGATGGCCAGCACAGAAACGGAGCGC
GTATATGAAAGGCAGATTGAAGAGCTCAGAAACGATATGCGGGAACTCGAGTCTAGAAACCTTGACGTTGACTCT
GTTGCAAGCCAGCTCAAGCAGCTAGAGGAGCTGGTCCAAGAACTCGAAGAGGGTCTTGAGGATGCTCGTCGCGGC
GAGGCAGAAGCTCGTGGCGAGGCCGAGTTTCTCCGAGGAGAGGTGGAGAGAACACGGTCGGAATTGCGTCGTGAG
CGAGAAAAAAGTGGCAAGGACACGGATGAAACAGGCAATTCTGCTGCAGCAGCTGCTTCTAGGGAGCTGGAGCAG
AAGGAAGATGAAATCCGCGGCCTCAAGACCATCATTCACTCGCTTAGTCGAGAAGCAATGCCGGAATCGGGCACA
GACTCCCGTCCCTCGGCATTACGTTCACTGACGCACAGCGGTACTGGGGAGACTTGGAGTGGCAAGAGCACGCGC
GATCAAATGGAACACAAGGTTGCCGAGCTGCAGGCTGCCTTGGAGAAGAAGAGTCTACGTGAAGGAGAGCTTGAA
CTGGAGCTCGAGATGCTACGCGGAGGGAGCCATAGCACCCAAGGCAGCTCGGTGCTAGCTCACCACTCGTCTCAA
CGGGACTCGCGCGACACAGTGGTTCCCATGGGAAGCAACTACTCGCGGTCTCCCGACACGACGCACAGGCGAACA
AAGACGCTCGACACAATGCCCGAAAGCGACACTGTGTCGACGGCCACAGAATCTAGCACCTTGTGGTGTGAGATT
TGCGAGACTGGTGGTCACGACATCCTGACTTGCACCAAGATGTTTGGCTCCGAGGACGCAAAGAGCGCCATTGAG
ACTCCATCTGTCAAGGGCGTGGACAGACGTCAAGGTCTCAAGCCTCGTGTAGCCGGTGTCGCTCATCCTGCGCCT
CTAGCTCCGGCCCGGGCAAAGACACCTGTGCCGACCAAGGCGCCTGCCATTAAGGTTCTTCCCAATCCCATGGAG
TCTGGGCCCGTTGCCGGCAAAGAGAGTGGCATCATGGATCCTGAGAAGTGGTGTGCTGTGTGTGAACGTGATGGC
CACGACAGCGTCGACTGTCCATTTGAGGAGGCCTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail