Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1688
Gene name
LocationContig_148:26865..28224
Strand-
Gene length (bp)1359
Transcript length (bp)1221
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 7.4E-08 46 80

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C1|YKU3_SCHPO Uncharacterized J domain-containing protein C2E1P5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.03 PE=3 SV=1 8 200 2.0E-34

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 160 182 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1688
MKVSYLSIGLLSLLTSLAWTWSKEDREIFRIRDEIAAHEQHPLATFYDYLDLPPTASLDDINRAYRQKSRLLHPD
KVKRQLKTDREAQQKAPKGGKAKVKKPSAAEERAAIKEASERQARLSLIVNILRGSSRDRYDHFLAHGFPLWKGT
DYYYNRYRPGLGTVIVGLFALVGGGLHYLVLYMSWKRQREFVERYVRFARDTAWGGSLGIPMAETPAVASGTTSD
DEAAPQVPMNRKQRRMQEKETRGRPKKSGRKVQGVSRDDSSGMGPSGVRKRVVAENGKILVVDSLGDVYLEEEDE
DGNVQEFLLDPEELQQPRFKDTALVRVPMWLLSVTVGRLGPMSTKGEGDGGDSLTGDSDAAQPTPSTDSAEEEFE
MVDKSTESLGRAKATGAQQTAKANKRKNRKR*
Coding >OphauB2|1688
ATGAAGGTTTCGTATCTTTCAATAGGACTGTTGTCCCTCCTGACTTCGCTGGCTTGGACATGGAGCAAAGAAGAC
CGCGAAATATTTCGGATTCGAGATGAAATCGCGGCGCACGAGCAGCATCCGCTGGCCACCTTTTACGACTATCTC
GACCTGCCGCCCACAGCGTCGCTCGACGACATCAACCGGGCATATCGCCAGAAGTCGCGGTTGCTTCACCCGGAC
AAGGTCAAGCGGCAGCTCAAAACGGATCGCGAGGCACAGCAGAAAGCTCCCAAGGGCGGCAAAGCCAAGGTGAAG
AAGCCGAGCGCTGCTGAGGAGCGGGCGGCAATCAAGGAGGCCTCGGAGCGCCAGGCGCGGCTGTCGCTCATTGTC
AACATCCTGCGTGGCTCGTCTCGTGACCGCTATGATCACTTTCTGGCCCATGGCTTCCCGCTCTGGAAGGGAACG
GATTACTACTACAACCGCTACCGGCCTGGGCTGGGCACTGTCATTGTTGGATTGTTCGCGCTTGTTGGCGGCGGC
TTGCACTACCTGGTACTTTACATGAGCTGGAAGCGGCAACGCGAGTTTGTCGAGCGCTATGTGCGCTTTGCTCGA
GACACGGCCTGGGGCGGCAGCCTCGGAATTCCCATGGCCGAGACGCCTGCCGTTGCGTCGGGCACGACGTCGGAC
GATGAGGCGGCCCCGCAGGTGCCCATGAATCGCAAGCAGCGGCGCATGCAGGAGAAGGAGACGCGTGGGCGTCCC
AAGAAGAGCGGACGCAAGGTGCAGGGCGTGTCGCGCGACGACTCGTCTGGCATGGGCCCCTCGGGAGTACGCAAG
AGAGTTGTGGCTGAAAACGGCAAGATTCTGGTTGTGGACTCGCTTGGGGACGTCTATCTCGAGGAGGAAGATGAA
GATGGCAATGTGCAAGAGTTCCTTTTGGATCCCGAGGAGCTCCAGCAGCCAAGGTTCAAGGACACGGCCTTGGTG
CGGGTGCCCATGTGGCTGCTGAGCGTCACTGTGGGGCGCCTGGGGCCCATGAGCACCAAGGGCGAGGGCGATGGC
GGTGACAGCCTCACGGGAGACTCGGACGCGGCGCAGCCGACGCCGAGCACCGACTCTGCCGAGGAGGAGTTTGAG
ATGGTGGACAAGAGCACCGAGTCGCTTGGGCGGGCCAAGGCGACGGGGGCGCAGCAGACGGCCAAGGCCAACAAG
AGGAAGAATCGGAAGCGTTGA
Transcript >OphauB2|1688
ATGAAGGTTTCGTATCTTTCAATAGGACTGTTGTCCCTCCTGACTTCGCTGGCTTGGACATGGAGCAAAGAAGAC
CGCGAAATATTTCGGATTCGAGATGAAATCGCGGCGCACGAGCAGCATCCGCTGGCCACCTTTTACGACTATCTC
GACCTGCCGCCCACAGCGTCGCTCGACGACATCAACCGGGCATATCGCCAGAAGTCGCGGTTGCTTCACCCGGAC
AAGGTCAAGCGGCAGCTCAAAACGGATCGCGAGGCACAGCAGAAAGCTCCCAAGGGCGGCAAAGCCAAGGTGAAG
AAGCCGAGCGCTGCTGAGGAGCGGGCGGCAATCAAGGAGGCCTCGGAGCGCCAGGCGCGGCTGTCGCTCATTGTC
AACATCCTGCGTGGCTCGTCTCGTGACCGCTATGATCACTTTCTGGCCCATGGCTTCCCGCTCTGGAAGGGAACG
GATTACTACTACAACCGCTACCGGCCTGGGCTGGGCACTGTCATTGTTGGATTGTTCGCGCTTGTTGGCGGCGGC
TTGCACTACCTGGTACTTTACATGAGCTGGAAGCGGCAACGCGAGTTTGTCGAGCGCTATGTGCGCTTTGCTCGA
GACACGGCCTGGGGCGGCAGCCTCGGAATTCCCATGGCCGAGACGCCTGCCGTTGCGTCGGGCACGACGTCGGAC
GATGAGGCGGCCCCGCAGGTGCCCATGAATCGCAAGCAGCGGCGCATGCAGGAGAAGGAGACGCGTGGGCGTCCC
AAGAAGAGCGGACGCAAGGTGCAGGGCGTGTCGCGCGACGACTCGTCTGGCATGGGCCCCTCGGGAGTACGCAAG
AGAGTTGTGGCTGAAAACGGCAAGATTCTGGTTGTGGACTCGCTTGGGGACGTCTATCTCGAGGAGGAAGATGAA
GATGGCAATGTGCAAGAGTTCCTTTTGGATCCCGAGGAGCTCCAGCAGCCAAGGTTCAAGGACACGGCCTTGGTG
CGGGTGCCCATGTGGCTGCTGAGCGTCACTGTGGGGCGCCTGGGGCCCATGAGCACCAAGGGCGAGGGCGATGGC
GGTGACAGCCTCACGGGAGACTCGGACGCGGCGCAGCCGACGCCGAGCACCGACTCTGCCGAGGAGGAGTTTGAG
ATGGTGGACAAGAGCACCGAGTCGCTTGGGCGGGCCAAGGCGACGGGGGCGCAGCAGACGGCCAAGGCCAACAAG
AGGAAGAATCGGAAGCGTTGA
Gene >OphauB2|1688
ATGAAGGTTTCGTATCTTTCAATAGGACTGTTGTCCCTCCTGACTTCGCTGGCTTGGACATGGAGCAAAGAAGGC
AAGTTGGCCCATTGGCTACGAGATGCAAGGTGGCCCGAGCTGACAATGCTTGGCCAGACCGCGAAATATTTCGGA
TTCGAGATGAAATCGCGGCGCACGAGCAGCATCCGCTGGCCACCTTTTACGACTATCTCGACCTGCCGCCCACAG
CGTCGCTCGACGACATCAACCGGGCATATCGCCAGAAGTCGCGGTTGCTTCACCCGGACAAGGTCAAGCGGCAGC
TCAAAACGGATCGCGAGGCACAGCAGAAAGCTCCCAAGGGCGGCAAAGCCAAGGTGAAGAAGCCGAGCGCTGCTG
AGGAGCGGGCGGCAATCAAGGAGGCCTCGGAGCGCCAGGCGCGGCTGTCGCTCATTGTCAACATCCTGCGTGGCT
CGTCTCGTGACCGCTATGATCACTTTCTGGCCCATGGCTTCCCGCTCTGGAAGGGAACGGATTACTACTACAACC
GCTACCGGCCTGGGCTGGGCACTGTCATTGTTGGATTGTTCGCGCTTGTTGGCGGCGGCTTGCACTACCTGGTAC
TTTACATGAGCTGGAAGCGGCAACGCGAGTTTGTCGAGCGCTATGTGCGCTTTGCTCGAGACACGGCCTGGGGCG
GCAGCCTCGGAATTCCCATGGCCGAGACGCCTGCCGTTGCGTCGGGCACGACGTCGGACGATGAGGCGGCCCCGC
AGGTGCCCATGAATCGCAAGCAGCGGCGCATGCAGGAGAAGGAGACGCGTGGGCGTCCCAAGAAGAGCGGACGCA
AGGTGCAGGGCGTGTCGCGCGACGACTCGTCTGGCATGGGCCCCTCGGGAGTACGCAAGAGAGTTGTGGCTGAAA
ACGGCAAGATTCTGGTTGTGGACTCGCTTGGGGACGTCTATCTCGAGGAGGAAGATGAAGATGGCAATGTGCAAG
AGTTCCTTTTGGATGTAAGCAGGCTGTGGCCCCCCATTGTCCCCATTGTACATGCAGCCGTTTTGATGCTGACGC
ATATGCGCCACAACACAGCCCGAGGAGCTCCAGCAGCCAAGGTTCAAGGACACGGCCTTGGTGCGGGTGCCCATG
TGGCTGCTGAGCGTCACTGTGGGGCGCCTGGGGCCCATGAGCACCAAGGGCGAGGGCGATGGCGGTGACAGCCTC
ACGGGAGACTCGGACGCGGCGCAGCCGACGCCGAGCACCGACTCTGCCGAGGAGGAGTTTGAGATGGTGGACAAG
AGCACCGAGTCGCTTGGGCGGGCCAAGGCGACGGGGGCGCAGCAGACGGCCAAGGCCAACAAGAGGAAGAATCGG
AAGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail