Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1687
Gene name
LocationContig_148:25978..26806
Strand+
Gene length (bp)828
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13821 DUF4187 Domain of unknown function (DUF4187) 2.7E-18 224 274
PF01585 G-patch G-patch domain 4.3E-07 75 118

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6DGZ0|GPT11_DANRE G patch domain-containing protein 11 OS=Danio rerio GN=gpatch11 PE=2 SV=1 9 275 7.0E-22
sp|Q6DF57|GPT11_XENTR G patch domain-containing protein 11 OS=Xenopus tropicalis GN=gpatch11 PE=2 SV=1 9 275 5.0E-18
sp|Q3UFS4|GPT11_MOUSE G patch domain-containing protein 11 OS=Mus musculus GN=Gpatch11 PE=1 SV=2 8 275 4.0E-17
sp|Q8N954|GPT11_HUMAN G patch domain-containing protein 11 OS=Homo sapiens GN=GPATCH11 PE=1 SV=3 8 275 1.0E-16
sp|Q2KI19|GPT11_BOVIN G patch domain-containing protein 11 OS=Bos taurus GN=GPATCH11 PE=2 SV=2 8 275 1.0E-16

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4670
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6067
Ophiocordyceps australis map64 (Brazil) OphauB2|1687 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00389
Ophiocordyceps camponoti-rufipedis Ophun1|3956
Ophiocordyceps kimflemingae Ophio5|759
Ophiocordyceps subramaniannii Hirsu2|9841

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1687
MAGTRDNADDQDYMNMSFADSDAKPETSLQRTRRLKLEALERGMVKSKAQHEQEVEAARKKGLATSLLHGPGAQQ
SKGLAMMAKMGFTGGGLGKTADGTATREPITISIKDGRGGIGLDSDKKRQQVDDAAHQDSLRAKRARCDAHDYRQ
RIGREQQEARRQAQFQAAQRLAQRLDQDGGNPPEQPVPLLYRRLVRQDHEAQDYATHYPTDSFHDDVELDHDAEL
DAFDALSPSDRLSKALQYLRSKHYYCFWCKMAYPTHHLTGCPGVTEEHHD*
Coding >OphauB2|1687
ATGGCAGGCACGCGCGACAATGCAGACGACCAAGACTACATGAACATGTCGTTTGCCGACAGCGACGCCAAACCA
GAAACGTCGCTGCAACGCACCCGGCGGCTCAAGCTCGAGGCGCTCGAGCGCGGCATGGTCAAGTCCAAGGCACAG
CATGAGCAAGAAGTCGAGGCAGCGCGCAAAAAGGGCCTCGCGACCTCTCTTCTCCATGGGCCTGGGGCGCAACAG
AGCAAGGGCCTGGCCATGATGGCCAAGATGGGCTTTACGGGCGGCGGGCTCGGCAAGACGGCAGATGGCACAGCG
ACACGCGAACCCATAACCATCAGCATCAAGGACGGCCGCGGCGGCATTGGCCTCGACAGCGACAAGAAGCGGCAG
CAAGTCGACGATGCTGCACATCAAGACTCTCTGCGCGCCAAGAGGGCCAGATGCGACGCCCACGACTATCGCCAG
CGCATCGGCCGCGAGCAGCAAGAGGCGCGGCGCCAAGCACAGTTCCAGGCCGCCCAGAGACTGGCCCAGCGCCTC
GACCAAGATGGCGGCAATCCGCCCGAGCAGCCAGTCCCGCTCCTCTACCGCCGCCTCGTGCGCCAGGACCACGAG
GCCCAAGACTACGCCACACACTACCCGACAGACTCTTTCCACGACGATGTAGAGCTCGACCACGATGCAGAGCTC
GACGCCTTTGATGCACTGAGCCCTAGCGACCGCTTATCCAAAGCTCTGCAGTACCTTCGCAGCAAACACTACTAC
TGTTTCTGGTGCAAAATGGCCTATCCCACCCACCACCTCACCGGATGTCCTGGCGTTACAGAGGAGCATCATGAC
TGA
Transcript >OphauB2|1687
ATGGCAGGCACGCGCGACAATGCAGACGACCAAGACTACATGAACATGTCGTTTGCCGACAGCGACGCCAAACCA
GAAACGTCGCTGCAACGCACCCGGCGGCTCAAGCTCGAGGCGCTCGAGCGCGGCATGGTCAAGTCCAAGGCACAG
CATGAGCAAGAAGTCGAGGCAGCGCGCAAAAAGGGCCTCGCGACCTCTCTTCTCCATGGGCCTGGGGCGCAACAG
AGCAAGGGCCTGGCCATGATGGCCAAGATGGGCTTTACGGGCGGCGGGCTCGGCAAGACGGCAGATGGCACAGCG
ACACGCGAACCCATAACCATCAGCATCAAGGACGGCCGCGGCGGCATTGGCCTCGACAGCGACAAGAAGCGGCAG
CAAGTCGACGATGCTGCACATCAAGACTCTCTGCGCGCCAAGAGGGCCAGATGCGACGCCCACGACTATCGCCAG
CGCATCGGCCGCGAGCAGCAAGAGGCGCGGCGCCAAGCACAGTTCCAGGCCGCCCAGAGACTGGCCCAGCGCCTC
GACCAAGATGGCGGCAATCCGCCCGAGCAGCCAGTCCCGCTCCTCTACCGCCGCCTCGTGCGCCAGGACCACGAG
GCCCAAGACTACGCCACACACTACCCGACAGACTCTTTCCACGACGATGTAGAGCTCGACCACGATGCAGAGCTC
GACGCCTTTGATGCACTGAGCCCTAGCGACCGCTTATCCAAAGCTCTGCAGTACCTTCGCAGCAAACACTACTAC
TGTTTCTGGTGCAAAATGGCCTATCCCACCCACCACCTCACCGGATGTCCTGGCGTTACAGAGGAGCATCATGAC
TGA
Gene >OphauB2|1687
ATGGCAGGCACGCGCGACAATGCAGACGACCAAGACTACATGAACATGTCGTTTGCCGACAGCGACGCCAAACCA
GAAACGTCGCTGCAACGCACCCGGCGGCTCAAGCTCGAGGCGCTCGAGCGCGGCATGGTCAAGTCCAAGGCACAG
CATGAGCAAGAAGTCGAGGCAGCGCGCAAAAAGGGCCTCGCGACCTCTCTTCTCCATGGGCCTGGGGCGCAACAG
AGCAAGGGCCTGGCCATGATGGCCAAGATGGGCTTTACGGGCGGCGGGCTCGGCAAGACGGCAGATGGCACAGCG
ACACGCGAACCCATAACCATCAGCATCAAGGACGGCCGCGGCGGCATTGGCCTCGACAGCGACAAGAAGCGGCAG
CAAGTCGACGATGCTGCACATCAAGACTCTCTGCGCGCCAAGAGGGCCAGATGCGACGCCCACGACTATCGCCAG
CGCATCGGCCGCGAGCAGCAAGAGGCGCGGCGCCAAGCACAGTTCCAGGCCGCCCAGAGACTGGCCCAGCGCCTC
GACCAAGATGGCGGCAATCCGCCCGAGCAGCCAGTCCCGCTCCTCTACCGCCGCCTCGTGCGCCAGGACCACGAG
GCCCAAGACTACGCCACACACTACCCGACAGACTCTTTCCACGACGATGTAGAGCTCGACCACGATGCAGAGCTC
GACGCCTTTGATGCACTGAGCCCTAGCGACCGCTTATCCAAAGCTCTGCAGTACCTTCGCAGCAAACACTACTAC
TGTTTCTGGTGCAAAATGGCCTATCCCACCCACCACCTCACCGGATGTCCTGGCGTTACAGAGGAGCATCATGAC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail