© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|1678 |
| Gene name | |
| Location | Contig_147:44314..45279 |
| Strand | + |
| Gene length (bp) | 965 |
| Transcript length (bp) | 906 |
| Coding sequence length (bp) | 906 |
| Protein length (aa) | 302 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00153 | Mito_carr | Mitochondrial carrier protein | 1.6E-13 | 12 | 97 |
| PF00153 | Mito_carr | Mitochondrial carrier protein | 4.1E-18 | 109 | 196 |
| PF00153 | Mito_carr | Mitochondrial carrier protein | 6.1E-20 | 206 | 297 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P40464|FLX1_YEAST | Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 | 10 | 296 | 1.0E-56 |
| sp|Q95J75|MFTC_MACFA | Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 | 17 | 296 | 2.0E-55 |
| sp|Q9H2D1|MFTC_HUMAN | Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 | 17 | 296 | 4.0E-55 |
| sp|Q8BMG8|MFTC_MOUSE | Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 | 17 | 296 | 2.0E-54 |
| sp|O13660|YBC9_SCHPO | Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 | 15 | 292 | 3.0E-45 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P40464|FLX1_YEAST | Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 | 10 | 296 | 1.0E-56 |
| sp|Q95J75|MFTC_MACFA | Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 | 17 | 296 | 2.0E-55 |
| sp|Q9H2D1|MFTC_HUMAN | Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 | 17 | 296 | 4.0E-55 |
| sp|Q8BMG8|MFTC_MOUSE | Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 | 17 | 296 | 2.0E-54 |
| sp|O13660|YBC9_SCHPO | Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 | 15 | 292 | 3.0E-45 |
| sp|Q7XA87|FOLT1_ARATH | Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 | 15 | 292 | 3.0E-42 |
| sp|Q54FU9|MCFW_DICDI | Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 | 14 | 301 | 5.0E-39 |
| sp|Q54QN2|MCFM_DICDI | Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 | 13 | 293 | 6.0E-35 |
| sp|Q9P6L7|YKQ9_SCHPO | Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 | 11 | 296 | 2.0E-33 |
| sp|Q3TZX3|S2533_MOUSE | Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 | 18 | 296 | 9.0E-33 |
| sp|Q1LZB3|S2533_BOVIN | Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 | 18 | 297 | 1.0E-32 |
| sp|Q9BSK2|S2533_HUMAN | Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 | 18 | 297 | 1.0E-32 |
| sp|P40556|YIA6_YEAST | Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 | 9 | 290 | 7.0E-32 |
| sp|Q6P036|S2533_DANRE | Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 | 18 | 297 | 4.0E-31 |
| sp|Q5ZKP7|S2536_CHICK | Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 | 14 | 297 | 4.0E-31 |
| sp|Q6DG32|S2536_DANRE | Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 | 14 | 297 | 5.0E-31 |
| sp|Q8RWA5|NDT2_ARATH | Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 | 32 | 290 | 3.0E-30 |
| sp|O22261|NDT1_ARATH | Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 | 32 | 296 | 4.0E-30 |
| sp|Q96CQ1|S2536_HUMAN | Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 | 14 | 297 | 4.0E-30 |
| sp|Q922G0|S2536_MOUSE | Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 | 14 | 297 | 4.0E-30 |
| sp|Q6GQS1|SCMC3_MOUSE | Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 | 15 | 296 | 8.0E-29 |
| sp|Q9BV35|SCMC3_HUMAN | Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 | 15 | 296 | 1.0E-28 |
| sp|A5PJZ1|SCMC1_BOVIN | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 | 15 | 296 | 8.0E-25 |
| sp|Q5RFB7|ODC_PONAB | Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 | 12 | 290 | 2.0E-24 |
| sp|Q76P23|PM34_DICDI | Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 | 4 | 292 | 3.0E-24 |
| sp|Q9BQT8|ODC_HUMAN | Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 | 12 | 290 | 8.0E-24 |
| sp|Q86I81|MCFI_DICDI | Mitochondrial substrate carrier family protein I OS=Dictyostelium discoideum GN=mcfI PE=2 SV=1 | 14 | 288 | 1.0E-23 |
| sp|Q7ZYD5|SCMC2_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 | 17 | 296 | 4.0E-23 |
| sp|Q0V7M4|SCMC2_BOVIN | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 | 17 | 296 | 4.0E-23 |
| sp|O04200|PXN_ARATH | Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana GN=PXN PE=1 SV=1 | 28 | 292 | 8.0E-23 |
| sp|Q7T0U6|SCM1B_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 | 15 | 296 | 8.0E-23 |
| sp|O18757|SCMC1_RABIT | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 | 15 | 296 | 1.0E-22 |
| sp|P39953|YEA6_YEAST | Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 | 14 | 297 | 1.0E-22 |
| sp|Q5XH95|SCMC2_XENTR | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 | 17 | 296 | 1.0E-22 |
| sp|Q6NUK1|SCMC1_HUMAN | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 | 15 | 296 | 1.0E-22 |
| sp|Q6NYZ6|SCM2A_DANRE | Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 | 17 | 293 | 1.0E-22 |
| sp|A2ASZ8|SCMC2_MOUSE | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 | 17 | 296 | 2.0E-22 |
| sp|O13844|YFG5_SCHPO | Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 | 17 | 298 | 2.0E-22 |
| sp|Q66L49|SCMC1_DANRE | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 | 18 | 290 | 2.0E-22 |
| sp|Q8K3P6|SCMC2_RAT | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 | 17 | 296 | 3.0E-22 |
| sp|Q5XHA0|SCMC1_XENTR | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 | 15 | 296 | 3.0E-22 |
| sp|P38127|RIM2_YEAST | Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 | 32 | 297 | 4.0E-22 |
| sp|Q8BMD8|SCMC1_MOUSE | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 | 15 | 296 | 5.0E-22 |
| sp|Q6KCM7|SCMC2_HUMAN | Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 | 17 | 296 | 9.0E-22 |
| sp|P33303|SFC1_YEAST | Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 | 14 | 297 | 1.0E-21 |
| sp|Q8N5S1|S2541_HUMAN | Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 | 17 | 296 | 2.0E-21 |
| sp|Q8BZ09|ODC_MOUSE | Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 | 9 | 290 | 4.0E-21 |
| sp|Q9UTD6|YID3_SCHPO | Uncharacterized mitochondrial carrier C227.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.03c PE=3 SV=1 | 32 | 297 | 5.0E-21 |
| sp|Q10248|YD1K_SCHPO | Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 | 9 | 296 | 2.0E-20 |
| sp|Q7ZY36|SCM1A_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 | 17 | 296 | 2.0E-20 |
| sp|Q9SUV1|BRT1_ARATH | Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 | 10 | 296 | 5.0E-20 |
| sp|A2CEQ0|SCM2B_DANRE | Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 | 17 | 296 | 6.0E-20 |
| sp|Q08DK7|MCATL_BOVIN | Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 | 14 | 295 | 7.0E-20 |
| sp|Q5HZE0|MCATL_RAT | Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 | 14 | 301 | 3.0E-19 |
| sp|Q8BVN7|S2541_MOUSE | Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 | 17 | 296 | 4.0E-19 |
| sp|Q8VZS0|PNC2_ARATH | Peroxisomal adenine nucleotide carrier 2 OS=Arabidopsis thaliana GN=PNC2 PE=1 SV=1 | 15 | 292 | 4.0E-19 |
| sp|B0G143|UCPB_DICDI | Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 | 18 | 290 | 8.0E-19 |
| sp|Q8N8R3|MCATL_HUMAN | Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 | 14 | 295 | 8.0E-19 |
| sp|Q54FE6|MCFS_DICDI | Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 | 15 | 292 | 9.0E-19 |
| sp|A7ER02|TPC1_SCLS1 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 | 13 | 292 | 1.0E-18 |
| sp|Q54BM3|MCFG_DICDI | Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 | 3 | 297 | 2.0E-18 |
| sp|A0JN87|ODC_BOVIN | Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 | 9 | 290 | 2.0E-18 |
| sp|Q99JD3|ODC_RAT | Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 | 15 | 290 | 3.0E-18 |
| sp|Q5EAC0|S2538_BOVIN | Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 | 9 | 292 | 4.0E-18 |
| sp|Q8BL03|MCATL_MOUSE | Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 | 14 | 295 | 4.0E-18 |
| sp|Q9MA90|PNC1_ARATH | Peroxisomal adenine nucleotide carrier 1 OS=Arabidopsis thaliana GN=PNC1 PE=1 SV=1 | 15 | 292 | 4.0E-18 |
| sp|Q9P6N6|S2538_SCHPO | Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 | 18 | 290 | 9.0E-18 |
| sp|P79110|TXTP_BOVIN | Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 | 17 | 297 | 9.0E-18 |
| sp|Q9CR58|KMCP1_MOUSE | Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 | 17 | 293 | 1.0E-17 |
| sp|Q75AH6|AGC1_ASHGO | Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 | 19 | 301 | 1.0E-17 |
| sp|Q5PQM9|KMCP1_RAT | Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 | 17 | 293 | 2.0E-17 |
| sp|Q86AV5|MCFX_DICDI | Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 | 11 | 300 | 2.0E-17 |
| sp|Q7S2H8|TPC1_NEUCR | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 | 18 | 296 | 3.0E-17 |
| sp|P38152|TXTP_YEAST | Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 | 17 | 292 | 3.0E-17 |
| sp|Q5SVS4|KMCP1_HUMAN | Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 | 17 | 293 | 3.0E-17 |
| sp|Q9LJX5|BRTL1_ARATH | Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 | 15 | 296 | 3.0E-17 |
| sp|A4RF23|TPC1_MAGO7 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 | 17 | 292 | 4.0E-17 |
| sp|Q9VAY3|MFRN_DROME | Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 | 14 | 296 | 4.0E-17 |
| sp|Q54MZ4|MCFB_DICDI | Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 | 17 | 296 | 7.0E-17 |
| sp|A6SL61|TPC1_BOTFB | Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 | 13 | 292 | 7.0E-17 |
| sp|Q8HXE3|KMCP1_MACFA | Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 | 17 | 293 | 8.0E-17 |
| sp|B0G159|MCFC_DICDI | Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 | 17 | 293 | 1.0E-16 |
| sp|Q20799|CMC2_CAEEL | Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 | 17 | 293 | 1.0E-16 |
| sp|O95258|UCP5_HUMAN | Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 | 17 | 293 | 2.0E-16 |
| sp|Q9W725|UCP2_CYPCA | Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 | 12 | 293 | 3.0E-16 |
| sp|O94502|YBT5_SCHPO | Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 | 114 | 296 | 3.0E-16 |
| sp|Q1E7P0|TPC1_COCIM | Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 | 18 | 292 | 4.0E-16 |
| sp|Q6FTE5|TPC1_CANGA | Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPC1 PE=3 SV=1 | 13 | 290 | 4.0E-16 |
| sp|Q9Z2B2|UCP5_MOUSE | Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 | 17 | 293 | 5.0E-16 |
| sp|P55851|UCP2_HUMAN | Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 | 12 | 296 | 5.0E-16 |
| sp|Q9LJX5|BRTL1_ARATH | Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 | 16 | 198 | 7.0E-16 |
| sp|Q9N2J1|UCP2_CANLF | Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 | 12 | 296 | 7.0E-16 |
| sp|B2VSU4|S2538_PYRTR | Solute carrier family 25 member 38 homolog OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_00728 PE=3 SV=1 | 18 | 292 | 7.0E-16 |
| sp|Q54W11|MCFL_DICDI | Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 | 17 | 296 | 9.0E-16 |
| sp|Q96CQ1|S2536_HUMAN | Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 | 106 | 296 | 1.0E-15 |
| sp|Q922G0|S2536_MOUSE | Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 | 106 | 296 | 1.0E-15 |
| sp|Q55DY8|MFRN_DICDI | Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 | 14 | 296 | 1.0E-15 |
| sp|Q54RB9|CMC_DICDI | Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 | 13 | 299 | 1.0E-15 |
| sp|A1CIF6|S2538_ASPCL | Solute carrier family 25 member 38 homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_051330 PE=3 SV=1 | 17 | 292 | 1.0E-15 |
| sp|Q0CT66|S2538_ASPTN | Solute carrier family 25 member 38 homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03118 PE=3 SV=1 | 18 | 292 | 2.0E-15 |
| sp|Q8JZU2|TXTP_MOUSE | Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 | 17 | 297 | 2.0E-15 |
| sp|Q1DRJ3|S2538_COCIM | Solute carrier family 25 member 38 homolog OS=Coccidioides immitis (strain RS) GN=CIMG_07070 PE=3 SV=1 | 9 | 292 | 3.0E-15 |
| sp|Q5R5A8|UCP2_PONAB | Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 | 12 | 296 | 3.0E-15 |
| sp|P53007|TXTP_HUMAN | Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 | 17 | 292 | 3.0E-15 |
| sp|Q5XGI1|KMCP1_XENTR | Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 | 17 | 293 | 5.0E-15 |
| sp|Q3SZK0|S2534_BOVIN | Solute carrier family 25 member 34 OS=Bos taurus GN=SLC25A34 PE=2 SV=1 | 11 | 293 | 6.0E-15 |
| sp|P32089|TXTP_RAT | Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 | 17 | 297 | 6.0E-15 |
| sp|Q9N2I9|UCP3_CANLF | Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 | 8 | 293 | 7.0E-15 |
| sp|P34519|TXTP_CAEEL | Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 | 32 | 297 | 7.0E-15 |
| sp|Q3SZI5|UCP2_BOVIN | Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 | 12 | 296 | 8.0E-15 |
| sp|Q9VQG4|COLT_DROME | Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 | 17 | 297 | 8.0E-15 |
| sp|Q27257|DIF1_CAEEL | Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 | 9 | 290 | 1.0E-14 |
| sp|Q628Z2|CMC3_CAEBR | Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 | 17 | 296 | 1.0E-14 |
| sp|Q6GQ22|KMCP1_XENLA | Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 | 17 | 293 | 1.0E-14 |
| sp|Q75A82|ANT1_ASHGO | Peroxisomal adenine nucleotide transporter 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ANT1 PE=3 SV=1 | 15 | 277 | 1.0E-14 |
| sp|Q4WQC5|S2538_ASPFU | Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12340 PE=3 SV=1 | 10 | 292 | 1.0E-14 |
| sp|B0Y4J4|S2538_ASPFC | Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_069300 PE=3 SV=1 | 10 | 292 | 1.0E-14 |
| sp|B2MVX9|S2538_SHEEP | Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 | 9 | 292 | 1.0E-14 |
| sp|Q55GE2|ODC_DICDI | Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 | 17 | 297 | 1.0E-14 |
| sp|Q54MZ4|MCFB_DICDI | Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 | 114 | 298 | 2.0E-14 |
| sp|P56500|UCP2_RAT | Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 | 12 | 301 | 2.0E-14 |
| sp|Q9QXX4|CMC2_MOUSE | Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 | 19 | 290 | 2.0E-14 |
| sp|Q6DJ08|S2538_XENTR | Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 | 1 | 292 | 2.0E-14 |
| sp|Q2UCW8|TPC1_ASPOR | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 | 17 | 296 | 2.0E-14 |
| sp|P70406|UCP2_MOUSE | Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 | 12 | 301 | 2.0E-14 |
| sp|Q18P97|UCP1_SUNMU | Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 | 1 | 299 | 2.0E-14 |
| sp|O75746|CMC1_HUMAN | Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 | 19 | 290 | 2.0E-14 |
| sp|Q5RBC8|CMC1_PONAB | Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 | 19 | 290 | 2.0E-14 |
| sp|Q9W720|UCP2_DANRE | Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 | 12 | 293 | 2.0E-14 |
| sp|O77792|UCP3_BOVIN | Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 | 8 | 293 | 2.0E-14 |
| sp|O43808|PM34_HUMAN | Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 | 14 | 292 | 2.0E-14 |
| sp|Q9LV81|BRTL3_ARATH | Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 | 18 | 296 | 3.0E-14 |
| sp|P97521|MCAT_RAT | Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 | 10 | 290 | 3.0E-14 |
| sp|Q8BH59|CMC1_MOUSE | Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 | 19 | 290 | 3.0E-14 |
| sp|A3LVX1|TPC1_PICST | Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 | 17 | 290 | 4.0E-14 |
| sp|Q19529|CMC3_CAEEL | Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 | 17 | 296 | 4.0E-14 |
| sp|Q94AG6|SAMC1_ARATH | S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 | 17 | 297 | 4.0E-14 |
| sp|O04619|ADNT1_ARATH | Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 | 114 | 296 | 4.0E-14 |
| sp|A6RAY2|S2538_AJECN | Solute carrier family 25 member 38 homolog OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06120 PE=3 SV=1 | 17 | 292 | 5.0E-14 |
| sp|O14281|YETC_SCHPO | Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 | 2 | 296 | 5.0E-14 |
| sp|A6RF73|TPC1_AJECN | Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 | 18 | 292 | 5.0E-14 |
| sp|Q9UJS0|CMC2_HUMAN | Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 | 19 | 290 | 5.0E-14 |
| sp|Q55E45|MCFE_DICDI | Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 | 17 | 294 | 6.0E-14 |
| sp|P0CI40|CMC1_YEASX | Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 | 114 | 297 | 8.0E-14 |
| sp|A4RPU0|S2538_MAGO7 | Solute carrier family 25 member 38 homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05623 PE=3 SV=1 | 17 | 292 | 8.0E-14 |
| sp|Q93XM7|MCAT_ARATH | Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 | 18 | 296 | 8.0E-14 |
| sp|O97649|UCP3_PIG | Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 | 8 | 293 | 8.0E-14 |
| sp|Q6DG32|S2536_DANRE | Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 | 106 | 296 | 1.0E-13 |
| sp|A1CWA4|S2538_NEOFI | Solute carrier family 25 member 38 homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_103940 PE=3 SV=1 | 18 | 292 | 1.0E-13 |
| sp|P56501|UCP3_MOUSE | Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 | 8 | 293 | 2.0E-13 |
| sp|P25874|UCP1_HUMAN | Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 | 7 | 299 | 2.0E-13 |
| sp|O97562|UCP2_PIG | Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 | 12 | 296 | 2.0E-13 |
| sp|F4HT41|SAMC2_ARATH | Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 | 17 | 297 | 2.0E-13 |
| sp|P22292|M2OM_BOVIN | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 | 10 | 293 | 2.0E-13 |
| sp|Q6CQR3|TPC1_KLULA | Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 | 17 | 290 | 2.0E-13 |
| sp|Q8HXW2|CMC2_MACFA | Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 | 19 | 290 | 2.0E-13 |
| sp|Q499U1|S2538_RAT | Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 | 9 | 292 | 3.0E-13 |
| sp|Q0CEN9|TPC1_ASPTN | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 | 17 | 291 | 3.0E-13 |
| sp|P53257|TPC1_YEAST | Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 | 16 | 296 | 4.0E-13 |
| sp|O94370|YG04_SCHPO | Uncharacterized mitochondrial carrier C1604.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.04 PE=3 SV=2 | 32 | 291 | 4.0E-13 |
| sp|P29518|BT1_MAIZE | Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 | 114 | 296 | 4.0E-13 |
| sp|Q75EP3|TPC1_ASHGO | Mitochondrial thiamine pyrophosphate carrier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPC1 PE=3 SV=1 | 15 | 299 | 4.0E-13 |
| sp|A5DIS9|TPC1_PICGU | Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 | 17 | 292 | 5.0E-13 |
| sp|Q7T292|MFRN2_DANRE | Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 | 109 | 299 | 5.0E-13 |
| sp|O70579|PM34_MOUSE | Peroxisomal membrane protein PMP34 OS=Mus musculus GN=Slc25a17 PE=1 SV=1 | 14 | 292 | 6.0E-13 |
| sp|Q9Z2Z6|MCAT_MOUSE | Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 | 10 | 297 | 6.0E-13 |
| sp|P0CAT2|S238B_DANRE | Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 | 11 | 292 | 6.0E-13 |
| sp|Q4X022|TPC1_ASPFU | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 | 17 | 291 | 7.0E-13 |
| sp|A6ZV78|TPC1_YEAS7 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 | 16 | 296 | 9.0E-13 |
| sp|A2Q9F0|S2538_ASPNC | Solute carrier family 25 member 38 homolog OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g07650 PE=3 SV=1 | 18 | 292 | 1.0E-12 |
| sp|P56499|UCP3_RAT | Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 | 8 | 293 | 1.0E-12 |
| sp|Q8C0K5|GDC_MOUSE | Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 | 114 | 293 | 1.0E-12 |
| sp|Q91XD8|S2538_MOUSE | Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 | 9 | 292 | 1.0E-12 |
| sp|O65023|EAAC_ARATH | Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 | 103 | 299 | 1.0E-12 |
| sp|Q76PC3|YQ73_SCHPO | Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 | 17 | 292 | 1.0E-12 |
| sp|Q0UUH1|TPC1_PHANO | Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 | 17 | 290 | 1.0E-12 |
| sp|Q6C6I3|S2538_YARLI | Solute carrier family 25 member 38 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E09284g PE=3 SV=1 | 18 | 292 | 1.0E-12 |
| sp|A1DI57|TPC1_NEOFI | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 | 17 | 290 | 1.0E-12 |
| sp|Q5ZKP7|S2536_CHICK | Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 | 106 | 296 | 2.0E-12 |
| sp|Q9BV35|SCMC3_HUMAN | Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 | 114 | 300 | 2.0E-12 |
| sp|Q7ZY36|SCM1A_XENLA | Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 | 113 | 300 | 2.0E-12 |
| sp|Q6DHC3|S2540_DANRE | Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 | 100 | 296 | 2.0E-12 |
| sp|Q5NVC1|TPC_PONAB | Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 | 115 | 294 | 2.0E-12 |
| sp|Q09834|YAD8_SCHPO | Uncharacterized mitochondrial carrier C4G8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.08 PE=3 SV=1 | 14 | 293 | 2.0E-12 |
| sp|Q9P3T7|ODC_SCHPO | Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 | 11 | 292 | 2.0E-12 |
| sp|P32332|OAC1_YEAST | Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 | 17 | 290 | 2.0E-12 |
| sp|Q6PIV7|S2534_HUMAN | Solute carrier family 25 member 34 OS=Homo sapiens GN=SLC25A34 PE=2 SV=1 | 11 | 293 | 2.0E-12 |
| sp|Q9CR62|M2OM_MOUSE | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 | 10 | 293 | 2.0E-12 |
| sp|Q6P036|S2533_DANRE | Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 | 106 | 299 | 3.0E-12 |
| sp|Q66H23|MFRN1_RAT | Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 | 13 | 297 | 3.0E-12 |
| sp|Q6DE75|S2538_XENLA | Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 | 9 | 292 | 3.0E-12 |
| sp|Q920G8|MFRN1_MOUSE | Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 | 109 | 301 | 3.0E-12 |
| sp|Q12251|YP011_YEAST | Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 | 114 | 301 | 3.0E-12 |
| sp|Q5AVW1|TPC1_EMENI | Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 | 17 | 290 | 4.0E-12 |
| sp|Q12375|ORT1_YEAST | Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 | 1 | 292 | 4.0E-12 |
| sp|Q9VA73|CMC_DROME | Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 | 19 | 290 | 4.0E-12 |
| sp|Q8R0Z5|MFRN2_MOUSE | Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 | 97 | 299 | 4.0E-12 |
| sp|Q96DW6|S2538_HUMAN | Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 | 9 | 292 | 4.0E-12 |
| sp|Q66H23|MFRN1_RAT | Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 | 109 | 301 | 5.0E-12 |
| sp|Q5XIF9|S2534_RAT | Solute carrier family 25 member 34 OS=Rattus norvegicus GN=Slc25a34 PE=2 SV=2 | 9 | 293 | 5.0E-12 |
| sp|Q8HXY2|MCAT_MACFA | Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 | 10 | 297 | 6.0E-12 |
| sp|Q6DHS9|S2548_DANRE | Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 | 15 | 290 | 6.0E-12 |
| sp|Q5IS35|TPC_MACFA | Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 | 115 | 294 | 7.0E-12 |
| sp|Q9DAM5|TPC_MOUSE | Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 | 115 | 293 | 7.0E-12 |
| sp|Q96A46|MFRN2_HUMAN | Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 | 109 | 299 | 7.0E-12 |
| sp|Q9HC21|TPC_HUMAN | Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 | 115 | 294 | 8.0E-12 |
| sp|Q9CA93|BAC2_ARATH | Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 | 3 | 204 | 8.0E-12 |
| sp|Q12251|YP011_YEAST | Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 | 12 | 292 | 1.0E-11 |
| sp|A2R5A0|TPC1_ASPNC | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 | 17 | 291 | 1.0E-11 |
| sp|O97470|ADT_DICDI | Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum GN=ancA PE=1 SV=1 | 1 | 293 | 1.0E-11 |
| sp|Q08CI8|S238A_DANRE | Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 | 11 | 292 | 1.0E-11 |
| sp|P29518|BT1_MAIZE | Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 | 102 | 293 | 2.0E-11 |
| sp|Q8HXY2|MCAT_MACFA | Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 | 115 | 299 | 2.0E-11 |
| sp|Q23125|MFRN_CAEEL | Mitoferrin OS=Caenorhabditis elegans GN=W02B12.9 PE=3 SV=1 | 14 | 297 | 2.0E-11 |
| sp|Q6CNY8|S2538_KLULA | Solute carrier family 25 member 38 homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0E08911g PE=3 SV=1 | 12 | 238 | 2.0E-11 |
| sp|Q02978|M2OM_HUMAN | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 | 10 | 293 | 2.0E-11 |
| sp|Q1LZB3|S2533_BOVIN | Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 | 103 | 299 | 3.0E-11 |
| sp|Q5NVC1|TPC_PONAB | Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 | 16 | 290 | 3.0E-11 |
| sp|Q920G8|MFRN1_MOUSE | Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 | 13 | 297 | 3.0E-11 |
| sp|P97700|M2OM_RAT | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus GN=Slc25a11 PE=1 SV=3 | 10 | 293 | 3.0E-11 |
| sp|Q10442|YDE9_SCHPO | Uncharacterized mitochondrial carrier C12B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.09 PE=3 SV=1 | 18 | 276 | 3.0E-11 |
| sp|Q9UBX3|DIC_HUMAN | Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 | 22 | 293 | 3.0E-11 |
| sp|P32331|YMC1_YEAST | Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 | 15 | 290 | 3.0E-11 |
| sp|Q287T7|MFRN1_DANRE | Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 | 18 | 297 | 3.0E-11 |
| sp|Q54B67|MCFZ_DICDI | Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 | 17 | 299 | 3.0E-11 |
| sp|A5DX39|TPC1_LODEL | Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 | 18 | 292 | 3.0E-11 |
| sp|Q9BSK2|S2533_HUMAN | Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 | 103 | 299 | 4.0E-11 |
| sp|A4RF23|TPC1_MAGO7 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 | 115 | 293 | 4.0E-11 |
| sp|Q5IS35|TPC_MACFA | Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 | 16 | 290 | 4.0E-11 |
| sp|Q01356|ARG13_NEUCR | Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 | 12 | 296 | 4.0E-11 |
| sp|Q03829|YM39_YEAST | Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 | 2 | 290 | 4.0E-11 |
| sp|B6ZJZ9|PNC1_SOYBN | Peroxisomal adenine nucleotide carrier 1 OS=Glycine max GN=PNC1 PE=2 SV=1 | 15 | 292 | 4.0E-11 |
| sp|Q2UU67|S2538_ASPOR | Solute carrier family 25 member 38 homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090009000436 PE=3 SV=1 | 18 | 292 | 4.0E-11 |
| sp|Q9Z2Z6|MCAT_MOUSE | Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 | 115 | 299 | 5.0E-11 |
| sp|P32332|OAC1_YEAST | Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 | 114 | 296 | 5.0E-11 |
| sp|Q9NYZ2|MFRN1_HUMAN | Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 | 18 | 297 | 5.0E-11 |
| sp|Q29RM1|TPC_BOVIN | Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 | 16 | 290 | 5.0E-11 |
| sp|Q12482|AGC1_YEAST | Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 | 19 | 301 | 5.0E-11 |
| sp|Q7T292|MFRN2_DANRE | Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 | 17 | 297 | 6.0E-11 |
| sp|A3KPP4|S2535_DANRE | Solute carrier family 25 member 35 OS=Danio rerio GN=slc25a35 PE=2 SV=1 | 14 | 293 | 6.0E-11 |
| sp|P16260|GDC_HUMAN | Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 | 114 | 293 | 6.0E-11 |
| sp|Q0II44|S2541_BOVIN | Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 | 17 | 238 | 6.0E-11 |
| sp|Q2H608|S2538_CHAGB | Solute carrier family 25 member 38 homolog OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05907 PE=3 SV=1 | 1 | 292 | 6.0E-11 |
| sp|Q9HC21|TPC_HUMAN | Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 | 16 | 290 | 7.0E-11 |
| sp|Q59Q36|TPC1_CANAL | Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 | 17 | 290 | 7.0E-11 |
| sp|Q9NYZ2|MFRN1_HUMAN | Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 | 109 | 298 | 8.0E-11 |
| sp|Q8N413|S2545_HUMAN | Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 | 15 | 290 | 8.0E-11 |
| sp|Q54DU1|MCFP_DICDI | Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 | 17 | 190 | 8.0E-11 |
| sp|Q01888|GDC_BOVIN | Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 | 114 | 293 | 8.0E-11 |
| sp|Q5XHA0|SCMC1_XENTR | Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 | 114 | 300 | 9.0E-11 |
| sp|P55916|UCP3_HUMAN | Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 | 8 | 293 | 9.0E-11 |
| sp|Q3TZX3|S2533_MOUSE | Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 | 103 | 296 | 1.0E-10 |
| sp|Q94AG6|SAMC1_ARATH | S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 | 70 | 292 | 1.0E-10 |
| sp|O04619|ADNT1_ARATH | Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 | 18 | 300 | 1.0E-10 |
| sp|Q9DAM5|TPC_MOUSE | Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 | 16 | 290 | 1.0E-10 |
| sp|Q74Z23|S2538_ASHGO | Solute carrier family 25 member 38 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGR383W PE=3 SV=1 | 4 | 292 | 1.0E-10 |
| sp|Q54BF6|MCFN_DICDI | Mitochondrial substrate carrier family protein N OS=Dictyostelium discoideum GN=mcfN PE=1 SV=2 | 114 | 290 | 1.0E-10 |
| sp|A7TIQ0|S2538_VANPO | Solute carrier family 25 member 38 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1043p32 PE=3 SV=1 | 17 | 292 | 1.0E-10 |
| sp|Q9M024|TAAC_ARATH | Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 | 32 | 299 | 1.0E-10 |
| sp|Q6DFK2|S2540_XENLA | Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 | 67 | 296 | 1.0E-10 |
| sp|A2ADF7|S2534_MOUSE | Solute carrier family 25 member 34 OS=Mus musculus GN=Slc25a34 PE=1 SV=1 | 9 | 293 | 2.0E-10 |
| sp|Q944H5|MTM1_ARATH | Mitochondrial carrier protein MTM1 OS=Arabidopsis thaliana GN=MTM1 PE=2 SV=1 | 91 | 296 | 2.0E-10 |
| sp|O43772|MCAT_HUMAN | Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 | 10 | 297 | 2.0E-10 |
| sp|P0C582|M2OM_NEUCR | Putative mitochondrial 2-oxoglutarate/malate carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic-33 PE=3 SV=1 | 19 | 290 | 2.0E-10 |
| sp|Q620A6|MFRN_CAEBR | Mitoferrin OS=Caenorhabditis briggsae GN=CBG02884 PE=3 SV=1 | 30 | 297 | 2.0E-10 |
| sp|P16261|GDC_RAT | Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 | 114 | 293 | 2.0E-10 |
| sp|Q6FTN2|DIC1_CANGA | Mitochondrial dicarboxylate transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIC1 PE=3 SV=1 | 19 | 295 | 2.0E-10 |
| sp|Q9XI74|PUMP3_ARATH | Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 | 17 | 293 | 2.0E-10 |
| sp|Q9FHX2|MFL1_ARATH | Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 | 28 | 300 | 2.0E-10 |
| sp|Q5PQ27|S2542_XENLA | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 | 17 | 175 | 2.0E-10 |
| sp|O46373|ADT1_RABIT | ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 | 15 | 296 | 3.0E-10 |
| sp|Q9M038|SFC1_ARATH | Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 | 11 | 292 | 3.0E-10 |
| sp|Q54EV4|MCFA_DICDI | Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 | 18 | 290 | 3.0E-10 |
| sp|Q9GMZ1|UCP1_CANLF | Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 | 32 | 299 | 4.0E-10 |
| sp|Q55E85|MCFD_DICDI | Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 | 15 | 297 | 4.0E-10 |
| sp|P04575|UCP1_MESAU | Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 | 9 | 299 | 4.0E-10 |
| sp|Q05AQ3|S2542_XENTR | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 | 17 | 290 | 4.0E-10 |
| sp|Q12482|AGC1_YEAST | Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 | 15 | 177 | 5.0E-10 |
| sp|O43772|MCAT_HUMAN | Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 | 115 | 299 | 5.0E-10 |
| sp|O81845|PUMP1_ARATH | Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 | 32 | 296 | 5.0E-10 |
| sp|Q9CA93|BAC2_ARATH | Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 | 31 | 301 | 6.0E-10 |
| sp|Q5PQ27|S2542_XENLA | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 | 18 | 290 | 6.0E-10 |
| sp|B0DK57|S2538_LACBS | Solute carrier family 25 member 38 homolog OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_191230 PE=3 SV=1 | 15 | 290 | 6.0E-10 |
| sp|Q21153|CMC1_CAEEL | Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 | 19 | 290 | 6.0E-10 |
| sp|Q54PY7|M2OM_DICDI | Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 | 15 | 300 | 7.0E-10 |
| sp|P14271|UCP1_RABIT | Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 | 18 | 205 | 7.0E-10 |
| sp|Q8R0Z5|MFRN2_MOUSE | Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 | 13 | 297 | 9.0E-10 |
| sp|P38087|YMC2_YEAST | Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 | 15 | 296 | 9.0E-10 |
| sp|Q9W725|UCP2_CYPCA | Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 | 2 | 198 | 1.0E-09 |
| sp|Q9N2J1|UCP2_CANLF | Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 | 2 | 198 | 1.0E-09 |
| sp|Q55DY8|MFRN_DICDI | Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 | 113 | 301 | 1.0E-09 |
| sp|P97521|MCAT_RAT | Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 | 102 | 299 | 1.0E-09 |
| sp|O97562|UCP2_PIG | Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 | 2 | 198 | 1.0E-09 |
| sp|Q96A46|MFRN2_HUMAN | Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 | 13 | 297 | 1.0E-09 |
| sp|Q287T7|MFRN1_DANRE | Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 | 113 | 298 | 1.0E-09 |
| sp|Q84UC7|BAC1_ARATH | Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 | 15 | 290 | 1.0E-09 |
| sp|Q84UC7|BAC1_ARATH | Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 | 102 | 296 | 1.0E-09 |
| sp|O60029|PET8_ASHGO | Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 | 114 | 293 | 1.0E-09 |
| sp|Q99297|ODC2_YEAST | Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 | 1 | 289 | 1.0E-09 |
| sp|A0PC02|UCP1_OCHDA | Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 | 17 | 197 | 1.0E-09 |
| sp|Q8TFH2|YIKC_SCHPO | Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 | 15 | 292 | 1.0E-09 |
| sp|Q19529|CMC3_CAEEL | Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 | 113 | 293 | 2.0E-09 |
| sp|P29518|BT1_MAIZE | Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 | 11 | 199 | 2.0E-09 |
| sp|Q6FR88|S2538_CANGA | Solute carrier family 25 member 38 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0H10538g PE=3 SV=1 | 9 | 296 | 2.0E-09 |
| sp|P04633|UCP1_RAT | Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 | 18 | 197 | 2.0E-09 |
| sp|Q00319|PM47B_CANBO | Peroxisomal membrane protein PMP47B OS=Candida boidinii GN=PMP47B PE=2 SV=1 | 70 | 238 | 2.0E-09 |
| sp|Q9ER18|UCP1_PHOSU | Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 | 20 | 299 | 2.0E-09 |
| sp|P10861|UCP1_BOVIN | Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 | 18 | 205 | 2.0E-09 |
| sp|Q54VX4|MCFJ_DICDI | Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 | 23 | 293 | 2.0E-09 |
| sp|Q9DB41|GHC2_MOUSE | Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 | 17 | 289 | 2.0E-09 |
| sp|Q75AH6|AGC1_ASHGO | Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 | 15 | 171 | 3.0E-09 |
| sp|Q9HC21|TPC_HUMAN | Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 | 13 | 190 | 3.0E-09 |
| sp|Q54DU1|MCFP_DICDI | Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 | 14 | 301 | 3.0E-09 |
| sp|Q9ER18|UCP1_PHOSU | Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 | 18 | 197 | 3.0E-09 |
| sp|Q54VX4|MCFJ_DICDI | Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 | 96 | 290 | 3.0E-09 |
| sp|Q8CFJ7|S2545_MOUSE | Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 | 15 | 290 | 3.0E-09 |
| sp|Q5B717|S2538_EMENI | Solute carrier family 25 member 38 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3663 PE=3 SV=2 | 10 | 292 | 3.0E-09 |
| sp|P12242|UCP1_MOUSE | Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 | 18 | 197 | 3.0E-09 |
| sp|Q000K2|ADT2_TACAC | ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 | 15 | 295 | 3.0E-09 |
| sp|P21245|PM47A_CANBO | Peroxisomal membrane protein PMP47A OS=Candida boidinii GN=PMP47A PE=1 SV=1 | 70 | 238 | 3.0E-09 |
| sp|Q0P483|S2542_DANRE | Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 | 17 | 290 | 3.0E-09 |
| sp|P51881|ADT2_MOUSE | ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 | 15 | 295 | 3.0E-09 |
| sp|Q5IS35|TPC_MACFA | Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 | 13 | 190 | 4.0E-09 |
| sp|Q9FY68|PUMP6_ARATH | Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 | 115 | 296 | 4.0E-09 |
| sp|Q09073|ADT2_RAT | ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 | 15 | 295 | 4.0E-09 |
| sp|P10566|MRS3_YEAST | Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 | 10 | 296 | 4.0E-09 |
| sp|Q9WVD5|ORNT1_MOUSE | Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 | 12 | 290 | 4.0E-09 |
| sp|Q8SQH5|ADT2_BOVIN | ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 | 15 | 295 | 4.0E-09 |
| sp|Q9BXI2|ORNT2_HUMAN | Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 | 12 | 290 | 4.0E-09 |
| sp|Q8C0K5|GDC_MOUSE | Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 | 17 | 296 | 5.0E-09 |
| sp|Q96U08|S2538_NEUCR | Solute carrier family 25 member 38 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7F18.090 PE=3 SV=1 | 1 | 292 | 5.0E-09 |
| sp|Q7PQV7|ADT2_ANOGA | ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 | 16 | 296 | 5.0E-09 |
| sp|Q5R5A8|UCP2_PONAB | Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 | 17 | 198 | 6.0E-09 |
| sp|Q9Y619|ORNT1_HUMAN | Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 | 12 | 290 | 6.0E-09 |
| sp|P31692|ADT_PARKE | ADP,ATP carrier protein OS=Parachlorella kessleri PE=3 SV=1 | 15 | 299 | 6.0E-09 |
| sp|Q4R8M0|ADT4_MACFA | ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 | 15 | 296 | 6.0E-09 |
| sp|P55851|UCP2_HUMAN | Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 | 17 | 198 | 7.0E-09 |
| sp|Q02978|M2OM_HUMAN | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 | 105 | 299 | 7.0E-09 |
| sp|Q9H0C2|ADT4_HUMAN | ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 | 15 | 296 | 7.0E-09 |
| sp|P02722|ADT1_BOVIN | ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 | 15 | 296 | 7.0E-09 |
| sp|P12235|ADT1_HUMAN | ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 | 15 | 296 | 7.0E-09 |
| sp|Q54FE6|MCFS_DICDI | Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 | 115 | 296 | 1.0E-08 |
| sp|Q75AH6|AGC1_ASHGO | Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 | 114 | 293 | 1.0E-08 |
| sp|Q3SZI5|UCP2_BOVIN | Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 | 2 | 198 | 1.0E-08 |
| sp|Q9W720|UCP2_DANRE | Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 | 2 | 198 | 1.0E-08 |
| sp|Q5AVW1|TPC1_EMENI | Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 | 105 | 293 | 1.0E-08 |
| sp|Q9M024|TAAC_ARATH | Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 | 163 | 300 | 1.0E-08 |
| sp|P32007|ADT3_BOVIN | ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 | 15 | 293 | 1.0E-08 |
| sp|Q9SJY5|PUMP5_ARATH | Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana GN=PUMP5 PE=2 SV=1 | 16 | 301 | 1.0E-08 |
| sp|Q5R5A1|ADT2_PONAB | ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 | 15 | 295 | 1.0E-08 |
| sp|Q05962|ADT1_RAT | ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 | 15 | 296 | 1.0E-08 |
| sp|O65023|EAAC_ARATH | Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 | 159 | 300 | 2.0E-08 |
| sp|P10566|MRS3_YEAST | Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 | 114 | 301 | 2.0E-08 |
| sp|Q6P316|S2540_XENTR | Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 | 67 | 296 | 2.0E-08 |
| sp|Q86HN8|MCFY_DICDI | Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 | 7 | 292 | 2.0E-08 |
| sp|Q7SXW0|S2539_DANRE | Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 | 114 | 297 | 2.0E-08 |
| sp|Q5U3V7|S2543_DANRE | Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 | 115 | 293 | 2.0E-08 |
| sp|Q9SB52|PUMP4_ARATH | Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 | 17 | 296 | 2.0E-08 |
| sp|P05141|ADT2_HUMAN | ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 | 15 | 295 | 2.0E-08 |
| sp|P48962|ADT1_MOUSE | ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 | 15 | 296 | 2.0E-08 |
| sp|Q2YDD9|ADT4_BOVIN | ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 | 6 | 297 | 2.0E-08 |
| sp|Q9CR62|M2OM_MOUSE | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 | 105 | 299 | 3.0E-08 |
| sp|Q9XI74|PUMP3_ARATH | Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 | 105 | 296 | 3.0E-08 |
| sp|Q9QZD8|DIC_MOUSE | Mitochondrial dicarboxylate carrier OS=Mus musculus GN=Slc25a10 PE=1 SV=2 | 22 | 296 | 3.0E-08 |
| sp|A7TDX5|TPC1_VANPO | Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 | 1 | 297 | 3.0E-08 |
| sp|Q12289|CRC1_YEAST | Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 | 17 | 290 | 3.0E-08 |
| sp|Q6QRN9|ADT3_PIG | ADP/ATP translocase 3 OS=Sus scrofa GN=SLC25A6 PE=2 SV=3 | 15 | 293 | 3.0E-08 |
| sp|Q3V132|ADT4_MOUSE | ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 | 15 | 297 | 3.0E-08 |
| sp|Q551X6|MCFV_DICDI | Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 | 112 | 293 | 3.0E-08 |
| sp|Q505J6|GHC2_RAT | Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 | 13 | 289 | 3.0E-08 |
| sp|O94502|YBT5_SCHPO | Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 | 113 | 293 | 4.0E-08 |
| sp|P55916|UCP3_HUMAN | Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 | 7 | 197 | 4.0E-08 |
| sp|Q26365|ADT_DROME | ADP,ATP carrier protein OS=Drosophila melanogaster GN=sesB PE=2 SV=4 | 16 | 296 | 4.0E-08 |
| sp|Q5NVC1|TPC_PONAB | Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 | 13 | 190 | 5.0E-08 |
| sp|P16260|GDC_HUMAN | Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 | 17 | 296 | 5.0E-08 |
| sp|P12236|ADT3_HUMAN | ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 | 15 | 293 | 5.0E-08 |
| sp|Q86AV5|MCFX_DICDI | Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 | 107 | 297 | 8.0E-08 |
| sp|Q1ECW7|S247A_DANRE | Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 | 17 | 190 | 9.0E-08 |
| sp|Q7S2H8|TPC1_NEUCR | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 | 103 | 297 | 1.0E-07 |
| sp|Q9VQG4|COLT_DROME | Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 | 114 | 293 | 1.0E-07 |
| sp|Q0CEN9|TPC1_ASPTN | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 | 105 | 301 | 1.0E-07 |
| sp|Q0P483|S2542_DANRE | Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 | 11 | 175 | 1.0E-07 |
| sp|Q8WUT9|S2543_HUMAN | Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 | 20 | 298 | 1.0E-07 |
| sp|Q6ZT89|S2548_HUMAN | Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 | 18 | 290 | 1.0E-07 |
| sp|Q9FM86|ADT5_ARATH | Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana GN=At5g56450 PE=2 SV=1 | 114 | 297 | 1.0E-07 |
| sp|P23500|MRS4_YEAST | Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 | 5 | 296 | 1.0E-07 |
| sp|Q05AQ3|S2542_XENTR | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 | 95 | 293 | 2.0E-07 |
| sp|Q8K404|UCP1_DICGR | Mitochondrial brown fat uncoupling protein 1 OS=Dicrostonyx groenlandicus GN=UCP1 PE=2 SV=1 | 16 | 299 | 2.0E-07 |
| sp|O13805|YE08_SCHPO | Uncharacterized mitochondrial carrier C17H9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.08 PE=3 SV=1 | 16 | 293 | 2.0E-07 |
| sp|Q96H78|S2544_HUMAN | Solute carrier family 25 member 44 OS=Homo sapiens GN=SLC25A44 PE=2 SV=1 | 17 | 293 | 2.0E-07 |
| sp|Q8BGF9|S2544_MOUSE | Solute carrier family 25 member 44 OS=Mus musculus GN=Slc25a44 PE=1 SV=1 | 17 | 293 | 2.0E-07 |
| sp|Q5RD67|S2544_PONAB | Solute carrier family 25 member 44 OS=Pongo abelii GN=SLC25A44 PE=2 SV=2 | 17 | 293 | 2.0E-07 |
| sp|Q6Q0C1|S2547_HUMAN | Solute carrier family 25 member 47 OS=Homo sapiens GN=SLC25A47 PE=2 SV=1 | 14 | 292 | 2.0E-07 |
| sp|A0PC02|UCP1_OCHDA | Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 | 20 | 299 | 3.0E-07 |
| sp|Q9D6M3|GHC1_MOUSE | Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 | 17 | 289 | 3.0E-07 |
| sp|P04633|UCP1_RAT | Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 | 20 | 299 | 4.0E-07 |
| sp|P10861|UCP1_BOVIN | Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 | 20 | 296 | 4.0E-07 |
| sp|P12242|UCP1_MOUSE | Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 | 9 | 299 | 4.0E-07 |
| sp|Q9BZJ4|S2539_HUMAN | Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 | 1 | 297 | 4.0E-07 |
| sp|Q9H1K4|GHC2_HUMAN | Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 | 5 | 289 | 4.0E-07 |
| sp|Q9M2Z8|MPCP2_ARATH | Mitochondrial phosphate carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MPT2 PE=2 SV=1 | 113 | 291 | 4.0E-07 |
| sp|Q55BF4|UCPA_DICDI | Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 | 17 | 297 | 4.0E-07 |
| sp|Q6IS41|S2547_MOUSE | Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 | 14 | 292 | 4.0E-07 |
| sp|Q8BGP6|S2540_MOUSE | Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 | 15 | 290 | 4.0E-07 |
| sp|Q6FTE5|TPC1_CANGA | Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPC1 PE=3 SV=1 | 104 | 295 | 5.0E-07 |
| sp|A1DI57|TPC1_NEOFI | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 | 105 | 297 | 5.0E-07 |
| sp|P97700|M2OM_RAT | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus GN=Slc25a11 PE=1 SV=3 | 105 | 299 | 5.0E-07 |
| sp|Q9C9R4|BRTL2_ARATH | Probable mitochondrial adenine nucleotide transporter BTL2 OS=Arabidopsis thaliana GN=At1g78180 PE=2 SV=1 | 18 | 297 | 5.0E-07 |
| sp|Q6GLA2|SAMC_XENTR | S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis GN=slc25a26 PE=2 SV=1 | 114 | 293 | 5.0E-07 |
| sp|Q01888|GDC_BOVIN | Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 | 17 | 296 | 6.0E-07 |
| sp|A5D9W9|S2538_PICGU | Solute carrier family 25 member 38 homolog OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00074 PE=3 SV=2 | 13 | 292 | 6.0E-07 |
| sp|Q0II44|S2541_BOVIN | Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 | 113 | 290 | 7.0E-07 |
| sp|Q5R5M0|MTCH2_PONAB | Mitochondrial carrier homolog 2 OS=Pongo abelii GN=MTCH2 PE=2 SV=2 | 150 | 285 | 7.0E-07 |
| sp|Q9Y6C9|MTCH2_HUMAN | Mitochondrial carrier homolog 2 OS=Homo sapiens GN=MTCH2 PE=1 SV=1 | 150 | 285 | 7.0E-07 |
| sp|Q86I81|MCFI_DICDI | Mitochondrial substrate carrier family protein I OS=Dictyostelium discoideum GN=mcfI PE=2 SV=1 | 11 | 176 | 8.0E-07 |
| sp|Q54EV4|MCFA_DICDI | Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 | 110 | 293 | 8.0E-07 |
| sp|Q498U3|S2540_RAT | Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 | 67 | 290 | 8.0E-07 |
| sp|Q5PQ27|S2542_XENLA | Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 | 100 | 293 | 9.0E-07 |
| sp|Q06143|DIC1_YEAST | Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 | 19 | 293 | 9.0E-07 |
| sp|Q5U680|SAMC_MOUSE | S-adenosylmethionine mitochondrial carrier protein OS=Mus musculus GN=Slc25a26 PE=1 SV=2 | 108 | 293 | 9.0E-07 |
| sp|P22292|M2OM_BOVIN | Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 | 105 | 299 | 1.0E-06 |
| sp|O94370|YG04_SCHPO | Uncharacterized mitochondrial carrier C1604.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.04 PE=3 SV=2 | 113 | 298 | 1.0E-06 |
| sp|Q4X022|TPC1_ASPFU | Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 | 105 | 297 | 1.0E-06 |
| sp|Q23125|MFRN_CAEEL | Mitoferrin OS=Caenorhabditis elegans GN=W02B12.9 PE=3 SV=1 | 113 | 300 | 1.0E-06 |
| sp|Q6PH61|S2534_DANRE | Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 | 19 | 293 | 1.0E-06 |
| sp|Q791V5|MTCH2_MOUSE | Mitochondrial carrier homolog 2 OS=Mus musculus GN=Mtch2 PE=1 SV=1 | 150 | 285 | 1.0E-06 |
| sp|Q6J329|S2547_RAT | Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 | 14 | 292 | 1.0E-06 |
| sp|Q5RD81|GHC1_PONAB | Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 | 17 | 289 | 1.0E-06 |
| sp|A2A3V2|S2543_MOUSE | Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 | 115 | 298 | 1.0E-06 |
| sp|Q4PDL5|S2538_USTMA | Solute carrier family 25 member 38 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10880 PE=3 SV=2 | 7 | 238 | 1.0E-06 |
| sp|A3LVX1|TPC1_PICST | Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 | 1 | 196 | 2.0E-06 |
| sp|Q9H936|GHC1_HUMAN | Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 | 17 | 289 | 2.0E-06 |
| sp|Q4V9P0|SAMC_DANRE | S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 | 13 | 293 | 2.0E-06 |
| sp|Q8BW66|S2548_MOUSE | Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 | 15 | 290 | 2.0E-06 |
| sp|Q7DNC3|MPCP1_ARATH | Mitochondrial phosphate carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=MPT1 PE=2 SV=1 | 13 | 239 | 2.0E-06 |
| sp|A6QR09|SAMC_BOVIN | S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 | 106 | 293 | 2.0E-06 |
| sp|A6SL61|TPC1_BOTFB | Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 | 11 | 177 | 3.0E-06 |
| sp|Q2UCW8|TPC1_ASPOR | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 | 105 | 301 | 3.0E-06 |
| sp|Q9UJS0|CMC2_HUMAN | Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 | 8 | 190 | 3.0E-06 |
| sp|A6S8E0|S2538_BOTFB | Solute carrier family 25 member 38 homolog OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_09631 PE=3 SV=1 | 18 | 292 | 3.0E-06 |
| sp|P38921|PET8_YEAST | Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 | 17 | 300 | 3.0E-06 |
| sp|Q3MHI3|S2548_BOVIN | Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 | 15 | 290 | 3.0E-06 |
| sp|B0G143|UCPB_DICDI | Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 | 106 | 296 | 4.0E-06 |
| sp|B0G159|MCFC_DICDI | Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 | 113 | 294 | 4.0E-06 |
| sp|P56501|UCP3_MOUSE | Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 | 108 | 300 | 4.0E-06 |
| sp|Q9VA73|CMC_DROME | Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 | 1 | 190 | 4.0E-06 |
| sp|Q8BGF9|S2544_MOUSE | Solute carrier family 25 member 44 OS=Mus musculus GN=Slc25a44 PE=1 SV=1 | 15 | 206 | 4.0E-06 |
| sp|Q641C8|SAMC_XENLA | S-adenosylmethionine mitochondrial carrier protein OS=Xenopus laevis GN=slc25a26 PE=2 SV=1 | 114 | 293 | 5.0E-06 |
| sp|O75746|CMC1_HUMAN | Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 | 1 | 190 | 6.0E-06 |
| sp|Q5RBC8|CMC1_PONAB | Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 | 1 | 190 | 6.0E-06 |
| sp|Q8BH59|CMC1_MOUSE | Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 | 1 | 190 | 6.0E-06 |
| sp|A2R5A0|TPC1_ASPNC | Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 | 105 | 293 | 6.0E-06 |
| sp|Q5U3V7|S2543_DANRE | Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 | 109 | 292 | 6.0E-06 |
| sp|P40614|MPCP_CAEEL | Phosphate carrier protein, mitochondrial OS=Caenorhabditis elegans GN=F01G4.6 PE=2 SV=1 | 20 | 297 | 6.0E-06 |
| sp|P40035|PIC2_YEAST | Mitochondrial phosphate carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIC2 PE=1 SV=1 | 130 | 292 | 6.0E-06 |
| sp|A7ER02|TPC1_SCLS1 | Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 | 1 | 177 | 7.0E-06 |
| sp|P56499|UCP3_RAT | Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 | 108 | 300 | 7.0E-06 |
| sp|Q8N5S1|S2541_HUMAN | Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 | 8 | 196 | 8.0E-06 |
| sp|Q27238|ADT1_ANOGA | ADP,ATP carrier protein 1 OS=Anopheles gambiae GN=AGAP006782 PE=2 SV=2 | 18 | 297 | 8.0E-06 |
| sp|A3M019|S2538_PICST | Solute carrier family 25 member 38 homolog OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_91291 PE=3 SV=2 | 4 | 292 | 8.0E-06 |
| sp|Q17QI7|S2539_BOVIN | Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 | 68 | 297 | 9.0E-06 |
| sp|Q6CQR3|TPC1_KLULA | Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 | 115 | 293 | 1.0E-05 |
| sp|Q86HN8|MCFY_DICDI | Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 | 115 | 293 | 1.0E-05 |
| sp|Q9C5M0|DTC_ARATH | Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 | 17 | 295 | 1.0E-05 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 30 | 0.45 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 69 | 91 | 22 |
| 2 | 112 | 134 | 22 |
| 3 | 167 | 189 | 22 |
| 4 | 265 | 287 | 22 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|1678 MRDTSHAGLSPATVEAVAGLSAGSAATLALHPLDIVKTRMQISRSRKPARPKTVPILRSMTSSPRPLESMYRGLM ASLVGNATSWSCFFFFKSKLEQAAVRMGQRSQPTATDYFIASGLAGLATSVLTNPIWVLKTRMLSSDRSAAGAYP SMLAGARTILATEGWRGFYRGLGVSMLGMSHTAVLFVVYEPAKQAVLARSIHSDDHLSVAATVGLSSLSKLAAVA ATYPYQVVRTRLQNYYRADRHCGKGICGVVVKMWTEEGLLGFYRGLVPSVIRVMPATWITFVVYENVKYYLSPSY D* |
| Coding | >OphauB2|1678 ATGCGTGATACCAGCCATGCGGGCCTCTCTCCCGCCACTGTCGAGGCTGTGGCGGGCCTCAGCGCTGGTAGCGCG GCGACTCTAGCGCTTCACCCTCTAGACATTGTCAAGACACGCATGCAGATCAGCAGAAGCAGAAAGCCTGCGCGT CCCAAGACAGTGCCCATTTTGCGGTCCATGACGTCTAGCCCGCGACCGCTGGAGTCGATGTACCGCGGCCTGATG GCCAGCCTGGTTGGCAACGCGACCAGCTGGTCATGCTTCTTCTTTTTCAAATCGAAGCTGGAGCAGGCCGCTGTC CGCATGGGCCAGCGCAGCCAGCCCACTGCAACGGACTACTTTATTGCCAGCGGTCTGGCCGGCCTGGCCACGTCG GTCCTGACGAATCCCATTTGGGTGCTCAAGACGCGCATGCTGTCGTCTGACCGCAGCGCAGCGGGCGCATATCCC TCGATGCTGGCTGGCGCGCGCACCATTCTGGCCACTGAGGGCTGGAGGGGCTTCTACCGCGGTCTGGGCGTCTCC ATGCTGGGCATGTCGCACACCGCCGTCCTGTTTGTCGTCTACGAGCCTGCCAAGCAAGCCGTCTTGGCACGCAGC ATCCACAGCGACGACCACCTGTCAGTGGCAGCGACGGTTGGCCTGTCGAGCCTTTCCAAGCTGGCTGCTGTCGCC GCGACGTATCCCTACCAGGTCGTGCGCACGCGACTACAAAACTACTATCGCGCTGACAGGCATTGTGGCAAGGGC ATTTGCGGCGTGGTGGTCAAGATGTGGACTGAGGAGGGCCTCTTGGGCTTCTACCGCGGCTTGGTGCCTAGCGTC ATCAGAGTCATGCCGGCCACATGGATCACCTTTGTGGTGTATGAAAATGTAAAGTACTACCTGTCGCCGTCATAC GATTGA |
| Transcript | >OphauB2|1678 ATGCGTGATACCAGCCATGCGGGCCTCTCTCCCGCCACTGTCGAGGCTGTGGCGGGCCTCAGCGCTGGTAGCGCG GCGACTCTAGCGCTTCACCCTCTAGACATTGTCAAGACACGCATGCAGATCAGCAGAAGCAGAAAGCCTGCGCGT CCCAAGACAGTGCCCATTTTGCGGTCCATGACGTCTAGCCCGCGACCGCTGGAGTCGATGTACCGCGGCCTGATG GCCAGCCTGGTTGGCAACGCGACCAGCTGGTCATGCTTCTTCTTTTTCAAATCGAAGCTGGAGCAGGCCGCTGTC CGCATGGGCCAGCGCAGCCAGCCCACTGCAACGGACTACTTTATTGCCAGCGGTCTGGCCGGCCTGGCCACGTCG GTCCTGACGAATCCCATTTGGGTGCTCAAGACGCGCATGCTGTCGTCTGACCGCAGCGCAGCGGGCGCATATCCC TCGATGCTGGCTGGCGCGCGCACCATTCTGGCCACTGAGGGCTGGAGGGGCTTCTACCGCGGTCTGGGCGTCTCC ATGCTGGGCATGTCGCACACCGCCGTCCTGTTTGTCGTCTACGAGCCTGCCAAGCAAGCCGTCTTGGCACGCAGC ATCCACAGCGACGACCACCTGTCAGTGGCAGCGACGGTTGGCCTGTCGAGCCTTTCCAAGCTGGCTGCTGTCGCC GCGACGTATCCCTACCAGGTCGTGCGCACGCGACTACAAAACTACTATCGCGCTGACAGGCATTGTGGCAAGGGC ATTTGCGGCGTGGTGGTCAAGATGTGGACTGAGGAGGGCCTCTTGGGCTTCTACCGCGGCTTGGTGCCTAGCGTC ATCAGAGTCATGCCGGCCACATGGATCACCTTTGTGGTGTATGAAAATGTAAAGTACTACCTGTCGCCGTCATAC GATTGA |
| Gene | >OphauB2|1678 ATGCGTGATACCAGCCATGCGGGCCTCTCTCCCGCCACTGTCGAGGCTGTGGCGGGCCTCAGCGCTGGTAGCGCG GCGACTCTAGCGCTTCACCCTCTAGACATTGTCAAGACACGCATGCAGAGTGAGTTGGGCGGCCCCCATGGCTGC TGAAGGATGCTGATGAAGACGTGCCTTGTCTAGTCAGCAGAAGCAGAAAGCCTGCGCGTCCCAAGACAGTGCCCA TTTTGCGGTCCATGACGTCTAGCCCGCGACCGCTGGAGTCGATGTACCGCGGCCTGATGGCCAGCCTGGTTGGCA ACGCGACCAGCTGGTCATGCTTCTTCTTTTTCAAATCGAAGCTGGAGCAGGCCGCTGTCCGCATGGGCCAGCGCA GCCAGCCCACTGCAACGGACTACTTTATTGCCAGCGGTCTGGCCGGCCTGGCCACGTCGGTCCTGACGAATCCCA TTTGGGTGCTCAAGACGCGCATGCTGTCGTCTGACCGCAGCGCAGCGGGCGCATATCCCTCGATGCTGGCTGGCG CGCGCACCATTCTGGCCACTGAGGGCTGGAGGGGCTTCTACCGCGGTCTGGGCGTCTCCATGCTGGGCATGTCGC ACACCGCCGTCCTGTTTGTCGTCTACGAGCCTGCCAAGCAAGCCGTCTTGGCACGCAGCATCCACAGCGACGACC ACCTGTCAGTGGCAGCGACGGTTGGCCTGTCGAGCCTTTCCAAGCTGGCTGCTGTCGCCGCGACGTATCCCTACC AGGTCGTGCGCACGCGACTACAAAACTACTATCGCGCTGACAGGCATTGTGGCAAGGGCATTTGCGGCGTGGTGG TCAAGATGTGGACTGAGGAGGGCCTCTTGGGCTTCTACCGCGGCTTGGTGCCTAGCGTCATCAGAGTCATGCCGG CCACATGGATCACCTTTGTGGTGTATGAAAATGTAAAGTACTACCTGTCGCCGTCATACGATTGA |