Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1677
Gene name
LocationContig_147:41729..42952
Strand-
Gene length (bp)1223
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.0E-14 15 85
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.5E-11 103 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 8 198 4.0E-75
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 8 198 1.0E-73
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 8 198 1.0E-73
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 8 189 2.0E-65
sp|Q55GD6|SF3B4_DICDI Splicing factor 3B subunit 4 OS=Dictyostelium discoideum GN=sf3b4 PE=3 SV=1 1 197 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 8 198 4.0E-75
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 8 198 1.0E-73
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 8 198 1.0E-73
sp|O14102|SAP49_SCHPO Spliceosome-associated protein 49 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sap49 PE=3 SV=2 8 189 2.0E-65
sp|Q55GD6|SF3B4_DICDI Splicing factor 3B subunit 4 OS=Dictyostelium discoideum GN=sf3b4 PE=3 SV=1 1 197 1.0E-46
sp|Q99181|HSH49_YEAST Protein HSH49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSH49 PE=1 SV=1 6 199 2.0E-34
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 13 183 1.0E-27
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 13 222 2.0E-25
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 13 183 2.0E-25
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 13 183 2.0E-25
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 13 183 2.0E-25
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 13 183 3.0E-25
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 13 183 3.0E-25
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 13 183 4.0E-25
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 13 200 1.0E-24
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 13 183 3.0E-24
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 13 200 3.0E-24
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 13 200 3.0E-24
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 13 200 4.0E-24
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 13 200 4.0E-24
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 13 181 4.0E-24
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 13 200 5.0E-24
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 13 183 1.0E-23
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 13 183 1.0E-23
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 13 200 2.0E-23
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 13 183 2.0E-23
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 13 183 2.0E-23
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 13 181 2.0E-23
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 13 183 3.0E-23
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 9 186 4.0E-23
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 13 183 4.0E-23
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 13 183 5.0E-23
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 13 201 2.0E-22
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 13 200 1.0E-21
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 13 183 1.0E-21
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 13 190 2.0E-21
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 13 188 3.0E-21
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 13 195 6.0E-21
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 8 174 1.0E-20
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 9 181 2.0E-20
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 13 188 2.0E-20
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 13 188 2.0E-20
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 10 181 7.0E-20
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 14 189 1.0E-19
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 15 202 2.0E-19
sp|Q5JQF8|PAP1M_HUMAN Polyadenylate-binding protein 1-like 2 OS=Homo sapiens GN=PABPC1L2A PE=2 SV=1 13 193 2.0E-19
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 14 190 2.0E-19
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 14 185 3.0E-19
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 13 167 4.0E-19
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 15 183 6.0E-19
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 13 174 7.0E-19
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 10 183 1.0E-18
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 13 183 4.0E-18
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 15 183 5.0E-18
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 15 183 5.0E-18
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 15 183 5.0E-18
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 9 245 6.0E-18
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 13 183 7.0E-18
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 14 185 7.0E-18
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 14 183 1.0E-17
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 17 174 1.0E-17
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 15 183 2.0E-17
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 11 339 2.0E-17
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 15 183 2.0E-17
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 17 174 2.0E-17
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 17 174 2.0E-17
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 17 174 2.0E-17
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 17 174 2.0E-17
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 17 174 2.0E-17
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 11 339 3.0E-17
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 13 202 4.0E-17
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 13 202 5.0E-17
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 15 183 6.0E-17
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 11 339 7.0E-17
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 11 339 7.0E-17
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 13 183 7.0E-17
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 11 339 8.0E-17
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 10 183 1.0E-16
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 11 183 2.0E-16
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 15 183 2.0E-16
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 13 316 2.0E-16
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 13 174 2.0E-16
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 14 167 2.0E-16
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 14 180 3.0E-16
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 15 189 4.0E-16
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 13 185 5.0E-16
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 14 180 5.0E-16
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 11 183 9.0E-16
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 14 180 9.0E-16
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 15 183 1.0E-15
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 15 207 1.0E-15
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 13 183 1.0E-15
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 13 362 2.0E-15
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 13 362 2.0E-15
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 8 186 2.0E-15
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 13 216 2.0E-15
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 13 203 2.0E-15
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 9 174 3.0E-15
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 15 189 4.0E-15
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 13 203 4.0E-15
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 12 193 5.0E-15
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 14 180 5.0E-15
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 13 202 6.0E-15
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 15 339 7.0E-15
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 11 203 7.0E-15
sp|Q54BM2|PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum GN=pabpc1A PE=1 SV=1 11 210 8.0E-15
sp|Q80YT9|RBM11_MOUSE Splicing regulator RBM11 OS=Mus musculus GN=Rbm11 PE=1 SV=1 8 86 9.0E-15
sp|O04425|FCA_ARATH Flowering time control protein FCA OS=Arabidopsis thaliana GN=FCA PE=1 SV=2 10 168 1.0E-14
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 13 205 2.0E-14
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 12 185 3.0E-14
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 13 183 3.0E-14
sp|P57052|RBM11_HUMAN Splicing regulator RBM11 OS=Homo sapiens GN=RBM11 PE=1 SV=1 8 86 3.0E-14
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 11 242 4.0E-14
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 12 185 5.0E-14
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 13 202 5.0E-14
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 11 242 7.0E-14
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 12 185 8.0E-14
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 12 193 9.0E-14
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 12 193 1.0E-13
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 5 186 2.0E-13
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 9 183 2.0E-13
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 15 199 9.0E-13
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 13 183 9.0E-13
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 12 193 1.0E-12
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 15 373 1.0E-12
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 12 183 1.0E-12
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 6 190 2.0E-12
sp|Q8CIN6|CELF3_MOUSE CUGBP Elav-like family member 3 OS=Mus musculus GN=Celf3 PE=2 SV=1 15 309 2.0E-12
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 8 164 3.0E-12
sp|Q9CQT2|RBM7_MOUSE RNA-binding protein 7 OS=Mus musculus GN=Rbm7 PE=1 SV=1 12 108 3.0E-12
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 8 164 3.0E-12
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 8 164 4.0E-12
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 10 174 4.0E-12
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 14 170 4.0E-12
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 10 191 5.0E-12
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 13 183 6.0E-12
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 13 197 8.0E-12
sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 12 185 9.0E-12
sp|Q5SZQ8|CELF3_HUMAN CUGBP Elav-like family member 3 OS=Homo sapiens GN=CELF3 PE=1 SV=1 15 309 9.0E-12
sp|Q08E07|CELF3_BOVIN CUGBP Elav-like family member 3 OS=Bos taurus GN=CELF3 PE=2 SV=1 15 309 9.0E-12
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 12 186 1.0E-11
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 1 174 1.0E-11
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 1 174 1.0E-11
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 1 174 1.0E-11
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 1 174 1.0E-11
sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 12 200 2.0E-11
sp|P0CP47|PABP_CRYNB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAB1 PE=3 SV=1 12 200 2.0E-11
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 13 183 2.0E-11
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 13 197 2.0E-11
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 14 180 2.0E-11
sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 15 194 2.0E-11
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 14 170 2.0E-11
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 1 174 2.0E-11
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 10 165 2.0E-11
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 14 170 2.0E-11
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 9 165 2.0E-11
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 10 165 2.0E-11
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 13 197 3.0E-11
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 9 165 3.0E-11
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 9 165 3.0E-11
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 9 165 3.0E-11
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 10 165 3.0E-11
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 10 165 4.0E-11
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 10 165 4.0E-11
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 10 165 4.0E-11
sp|P70372|ELAV1_MOUSE ELAV-like protein 1 OS=Mus musculus GN=Elavl1 PE=1 SV=2 22 165 5.0E-11
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 15 164 6.0E-11
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 6 181 8.0E-11
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 9 89 8.0E-11
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 14 193 9.0E-11
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 15 177 9.0E-11
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 13 136 1.0E-10
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 8 164 1.0E-10
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 11 180 1.0E-10
sp|Q3MHY8|RBM7_BOVIN RNA-binding protein 7 OS=Bos taurus GN=RBM7 PE=2 SV=1 12 86 1.0E-10
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 15 164 1.0E-10
sp|Q91903|ELAV2_XENLA ELAV-like protein 2 OS=Xenopus laevis GN=elavl2 PE=1 SV=2 9 165 1.0E-10
sp|Q15717|ELAV1_HUMAN ELAV-like protein 1 OS=Homo sapiens GN=ELAVL1 PE=1 SV=2 22 165 1.0E-10
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 11 180 1.0E-10
sp|Q9Y580|RBM7_HUMAN RNA-binding protein 7 OS=Homo sapiens GN=RBM7 PE=1 SV=1 12 99 2.0E-10
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 12 186 3.0E-10
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 22 165 3.0E-10
sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 11 165 3.0E-10
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 5 323 5.0E-10
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 8 89 5.0E-10
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 10 165 5.0E-10
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 13 203 6.0E-10
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 2 170 6.0E-10
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 2 170 7.0E-10
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 2 170 7.0E-10
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 2 170 7.0E-10
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 2 170 7.0E-10
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 2 170 7.0E-10
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 8 164 7.0E-10
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 13 136 8.0E-10
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 13 357 9.0E-10
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 13 136 1.0E-09
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 13 136 1.0E-09
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 12 193 1.0E-09
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 14 89 1.0E-09
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 14 89 1.0E-09
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 14 101 1.0E-09
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 15 163 1.0E-09
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 14 89 1.0E-09
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 14 89 1.0E-09
sp|A0JM51|CELF5_XENTR CUGBP Elav-like family member 5 OS=Xenopus tropicalis GN=celf5 PE=2 SV=1 2 195 1.0E-09
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 13 183 2.0E-09
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 15 210 2.0E-09
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 10 199 2.0E-09
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 15 183 3.0E-09
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 12 164 3.0E-09
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 3 167 3.0E-09
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 13 136 4.0E-09
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 10 208 4.0E-09
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 13 89 4.0E-09
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 13 89 4.0E-09
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 3 173 5.0E-09
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 14 89 5.0E-09
sp|Q91579|CEL3A_XENLA CUGBP Elav-like family member 3-A OS=Xenopus laevis GN=tnrc4-a PE=2 SV=2 15 248 5.0E-09
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 15 159 6.0E-09
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 12 204 7.0E-09
sp|Q7ZWM3|CEL3B_XENLA CUGBP Elav-like family member 3-B OS=Xenopus laevis GN=tnrc4-b PE=2 SV=1 15 195 7.0E-09
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 12 215 8.0E-09
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 13 183 8.0E-09
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 10 199 9.0E-09
sp|Q7TSY6|CELF4_MOUSE CUGBP Elav-like family member 4 OS=Mus musculus GN=Celf4 PE=1 SV=2 15 195 9.0E-09
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 13 89 9.0E-09
sp|Q5NVC8|CELF4_PONAB CUGBP Elav-like family member 4 OS=Pongo abelii GN=CELF4 PE=2 SV=2 15 195 9.0E-09
sp|Q9BZC1|CELF4_HUMAN CUGBP Elav-like family member 4 OS=Homo sapiens GN=CELF4 PE=1 SV=1 15 195 9.0E-09
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 14 89 1.0E-08
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 13 89 1.0E-08
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 13 89 1.0E-08
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 13 89 1.0E-08
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 13 89 1.0E-08
sp|Q6GLB5|ELAV1_XENTR ELAV-like protein 1 OS=Xenopus tropicalis GN=elavl1 PE=2 SV=1 22 165 1.0E-08
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 11 164 1.0E-08
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 8 90 1.0E-08
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 11 183 1.0E-08
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 14 95 1.0E-08
sp|Q503H1|TSAP1_DANRE tRNA selenocysteine 1-associated protein 1 OS=Danio rerio GN=trnau1ap PE=2 SV=1 14 173 2.0E-08
sp|O01671|SXL_MEGSC Sex-lethal homolog OS=Megaselia scalaris GN=SXL PE=2 SV=3 29 159 2.0E-08
sp|Q24668|SXL_DROSU Protein sex-lethal OS=Drosophila subobscura GN=Sxl PE=2 SV=2 6 162 2.0E-08
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 8 89 2.0E-08
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 11 167 2.0E-08
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 22 165 3.0E-08
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 8 90 3.0E-08
sp|Q9IBD1|CELF3_DANRE CUGBP Elav-like family member 3 OS=Danio rerio GN=celf3 PE=2 SV=2 15 218 3.0E-08
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 12 89 3.0E-08
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 15 167 4.0E-08
sp|Q8N6W0|CELF5_HUMAN CUGBP Elav-like family member 5 OS=Homo sapiens GN=CELF5 PE=1 SV=1 15 195 4.0E-08
sp|B4MM23|SHEP_DROWI Protein alan shepard OS=Drosophila willistoni GN=shep PE=3 SV=2 8 167 4.0E-08
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 15 174 5.0E-08
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 13 135 6.0E-08
sp|P48809|RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster GN=Hrb27C PE=1 SV=2 8 191 6.0E-08
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 12 164 6.0E-08
sp|B4LFQ9|SHEP_DROVI Protein alan shepard OS=Drosophila virilis GN=shep PE=3 SV=2 12 167 7.0E-08
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 15 251 9.0E-08
sp|P19339|SXL_DROME Protein sex-lethal OS=Drosophila melanogaster GN=Sxl PE=1 SV=1 24 162 9.0E-08
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 12 197 1.0E-07
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 14 95 1.0E-07
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 14 95 1.0E-07
sp|Q3ZBP3|RBMS1_BOVIN RNA-binding motif, single-stranded-interacting protein 1 OS=Bos taurus GN=RBMS1 PE=2 SV=1 7 167 1.0E-07
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 14 95 1.0E-07
sp|P29558|RBMS1_HUMAN RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens GN=RBMS1 PE=1 SV=3 7 167 1.0E-07
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 14 95 1.0E-07
sp|B4PIS2|SHEP_DROYA Protein alan shepard OS=Drosophila yakuba GN=shep PE=3 SV=1 12 167 1.0E-07
sp|Q91W59|RBMS1_MOUSE RNA-binding motif, single-stranded-interacting protein 1 OS=Mus musculus GN=Rbms1 PE=1 SV=1 7 167 1.0E-07
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 14 89 1.0E-07
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 8 90 1.0E-07
sp|B3NGA1|SHEP_DROER Protein alan shepard OS=Drosophila erecta GN=shep PE=3 SV=1 12 167 1.0E-07
sp|Q5PQP1|RBMS1_RAT RNA-binding motif, single-stranded-interacting protein 1 OS=Rattus norvegicus GN=Rbms1 PE=2 SV=1 7 167 1.0E-07
sp|B4IX08|SHEP_DROGR Protein alan shepard OS=Drosophila grimshawi GN=shep PE=3 SV=1 12 167 1.0E-07
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 8 90 2.0E-07
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 8 90 2.0E-07
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 8 90 2.0E-07
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 8 90 2.0E-07
sp|B4HUE4|SHEP_DROSE Protein alan shepard OS=Drosophila sechellia GN=shep PE=3 SV=1 12 167 2.0E-07
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 8 90 2.0E-07
sp|Q8MSV2|SHEP_DROME Protein alan shepard OS=Drosophila melanogaster GN=shep PE=1 SV=2 12 167 2.0E-07
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 8 90 2.0E-07
sp|Q62826|HNRPM_RAT Heterogeneous nuclear ribonucleoprotein M OS=Rattus norvegicus GN=Hnrnpm PE=1 SV=4 54 170 2.0E-07
sp|Q09511|RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=3 SV=1 13 93 2.0E-07
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 8 89 2.0E-07
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 13 170 3.0E-07
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 12 192 3.0E-07
sp|Q6DGV1|CELF4_DANRE CUGBP Elav-like family member 4 OS=Danio rerio GN=celf4 PE=2 SV=1 15 195 3.0E-07
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 11 89 3.0E-07
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 11 89 3.0E-07
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 15 181 3.0E-07
sp|O61374|SXL_CERCA Sex-lethal homolog OS=Ceratitis capitata GN=SXL PE=2 SV=2 24 162 4.0E-07
sp|Q3ZC34|RBMS2_BOVIN RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus GN=RBMS2 PE=2 SV=1 8 167 4.0E-07
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 55 181 4.0E-07
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 11 89 4.0E-07
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 12 167 4.0E-07
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 8 89 4.0E-07
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 8 184 4.0E-07
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 8 89 4.0E-07
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 8 89 4.0E-07
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 8 89 4.0E-07
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 8 90 4.0E-07
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 13 136 5.0E-07
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 8 90 5.0E-07
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 8 89 5.0E-07
sp|Q96J87|CELF6_HUMAN CUGBP Elav-like family member 6 OS=Homo sapiens GN=CELF6 PE=1 SV=1 15 197 5.0E-07
sp|Q9SEU4|SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana GN=SCL33 PE=1 SV=1 9 99 5.0E-07
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 12 89 5.0E-07
sp|Q9Y6V0|PCLO_HUMAN Protein piccolo OS=Homo sapiens GN=PCLO PE=1 SV=4 209 379 5.0E-07
sp|Q9LHP2|SL30A_ARATH Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana GN=SCL30A PE=1 SV=1 13 113 5.0E-07
sp|Q7TN33|CELF6_MOUSE CUGBP Elav-like family member 6 OS=Mus musculus GN=Celf6 PE=2 SV=1 15 197 5.0E-07
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 14 164 7.0E-07
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 12 89 7.0E-07
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 12 89 7.0E-07
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 12 89 7.0E-07
sp|Q1RMJ7|TSAP1_BOVIN tRNA selenocysteine 1-associated protein 1 OS=Bos taurus GN=TRNAU1AP PE=2 SV=1 13 164 7.0E-07
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 15 173 7.0E-07
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 15 173 7.0E-07
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 15 173 7.0E-07
sp|Q9NX07|TSAP1_HUMAN tRNA selenocysteine 1-associated protein 1 OS=Homo sapiens GN=TRNAU1AP PE=1 SV=1 13 164 7.0E-07
sp|Q9QZI7|TSAP1_RAT tRNA selenocysteine 1-associated protein 1 OS=Rattus norvegicus GN=Trnau1ap PE=1 SV=1 13 164 8.0E-07
sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 15 176 9.0E-07
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 11 164 9.0E-07
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 14 95 9.0E-07
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 14 95 9.0E-07
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 3 184 9.0E-07
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 3 184 9.0E-07
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 3 184 9.0E-07
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 15 175 1.0E-06
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 15 173 1.0E-06
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 8 184 1.0E-06
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 96 194 1.0E-06
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 11 89 1.0E-06
sp|O17310|SXL_MUSDO Sex-lethal homolog OS=Musca domestica GN=SXL PE=2 SV=1 24 162 1.0E-06
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 13 136 2.0E-06
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 13 324 2.0E-06
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 12 173 2.0E-06
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 3 184 2.0E-06
sp|Q8LFS6|BRN1L_ARATH RNA-binding protein BRN1 OS=Arabidopsis thaliana GN=BRN1 PE=2 SV=1 13 201 2.0E-06
sp|Q8VC70|RBMS2_MOUSE RNA-binding motif, single-stranded-interacting protein 2 OS=Mus musculus GN=Rbms2 PE=1 SV=1 8 167 2.0E-06
sp|P90727|U2AF2_CAEBR Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis briggsae GN=uaf-1 PE=3 SV=2 54 187 2.0E-06
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 14 95 2.0E-06
sp|Q80VC6|TSAP1_MOUSE tRNA selenocysteine 1-associated protein 1 OS=Mus musculus GN=Trnau1ap PE=1 SV=2 13 164 2.0E-06
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 15 159 2.0E-06
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 15 184 2.0E-06
sp|Q9BRL6|SRSF8_HUMAN Serine/arginine-rich splicing factor 8 OS=Homo sapiens GN=SRSF8 PE=1 SV=1 14 89 2.0E-06
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 15 184 2.0E-06
sp|Q5R462|TSAP1_PONAB tRNA selenocysteine 1-associated protein 1 OS=Pongo abelii GN=TRNAU1AP PE=2 SV=1 13 164 2.0E-06
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 15 167 3.0E-06
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 11 188 3.0E-06
sp|O97018|SXL_CHRRU Sex-lethal homolog OS=Chrysomya rufifacies GN=SXL PE=2 SV=2 24 162 3.0E-06
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 12 173 3.0E-06
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 15 172 3.0E-06
sp|A4QNI8|ELAV4_XENTR ELAV-like protein 4 OS=Xenopus tropicalis GN=elavl4 PE=2 SV=1 55 165 3.0E-06
sp|Q7SZT7|ELAV4_XENLA ELAV-like protein 4 OS=Xenopus laevis GN=elavl4 PE=2 SV=1 10 165 3.0E-06
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 15 173 3.0E-06
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 15 178 3.0E-06
sp|Q1JQ73|ELV1A_XENLA ELAV-like protein 1-A OS=Xenopus laevis GN=elavl1-a PE=1 SV=1 22 165 3.0E-06
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 14 96 3.0E-06
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 12 183 4.0E-06
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 15 167 4.0E-06
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 15 173 4.0E-06
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 15 173 4.0E-06
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 15 173 4.0E-06
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 8 184 4.0E-06
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 13 200 4.0E-06
sp|P39684|PES4_YEAST Protein PES4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PES4 PE=3 SV=2 5 213 4.0E-06
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 14 193 4.0E-06
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 12 192 5.0E-06
sp|P90978|U2AF2_CAEEL Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis elegans GN=uaf-1 PE=2 SV=2 54 183 5.0E-06
sp|O43390|HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 15 165 6.0E-06
sp|Q8L716|U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 15 89 6.0E-06
sp|Q8SR30|PABP_ENCCU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Encephalitozoon cuniculi (strain GB-M1) GN=PAB1 PE=1 SV=1 14 175 6.0E-06
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 55 175 6.0E-06
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 15 159 7.0E-06
sp|Q7TP47|HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus GN=Syncrip PE=2 SV=1 20 196 9.0E-06
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 8 173 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1677
MAQNRHWEQDKEATVYVGNIDERVTPAVLYEIMVQMGPVHNLHMPRDRITQNHQGFGFVEFRGPQDADYAAAIMN
GIKLFGKPIRVNKASADKQKAADVGAILFVGNLDQMVDEKILCDTFCRFGTLLSVPKIMRDDEGNSKCYAFVSFA
DFDSSDNAINNIQGQYILSKQAVVEYALKKDGRGERHGDEAERQLAAQAKLRDIVPEAQPIPQAFLQQGPSLGAV
NPAAAPPAMPNAAPVPPAGFDASAMPLAASPAAAASHGMPSGFVPPPHRAPPPYNMAGVPMAPSPALPGRGAAPL
PPAPQGLPARPPHAQPGFPRPPDYHLGNFHPPNSSPVPQGFPIGPPPPGFPAPPPVGAASPPVMPPGFQPPPGFQ
PPPGYHRR*
Coding >OphauB2|1677
ATGGCTCAGAACCGACATTGGGAGCAGGACAAGGAGGCGACAGTATACGTGGGAAACATTGATGAGCGCGTCACT
CCGGCTGTCCTGTACGAAATAATGGTGCAAATGGGCCCGGTGCACAACCTGCACATGCCGCGCGATCGCATCACG
CAGAACCACCAGGGATTTGGCTTTGTCGAGTTTCGCGGCCCCCAAGACGCCGACTATGCCGCTGCCATTATGAAT
GGCATCAAGCTGTTTGGCAAGCCCATTCGCGTCAACAAGGCCAGCGCTGACAAGCAAAAAGCGGCTGATGTCGGC
GCCATTCTATTTGTTGGAAATCTCGATCAAATGGTGGACGAAAAGATTCTCTGCGACACCTTTTGCCGCTTTGGA
ACCCTTCTCTCCGTGCCCAAGATTATGCGCGACGACGAGGGCAACAGCAAATGCTACGCTTTTGTCAGCTTTGCC
GACTTTGACAGCAGCGACAATGCCATCAACAACATCCAAGGACAGTACATTCTCAGCAAGCAGGCTGTCGTCGAG
TACGCCCTCAAAAAGGATGGCCGTGGCGAGCGTCACGGAGACGAGGCTGAGCGCCAGCTGGCAGCTCAGGCCAAG
TTGCGCGACATCGTCCCCGAGGCCCAGCCCATCCCCCAGGCCTTCTTGCAACAGGGCCCGTCTCTGGGTGCCGTC
AATCCTGCTGCTGCTCCCCCTGCCATGCCCAATGCCGCTCCCGTGCCCCCGGCTGGTTTCGATGCTTCAGCAATG
CCTCTAGCCGCCTCCCCCGCCGCCGCGGCTTCTCATGGCATGCCCAGCGGCTTTGTACCGCCGCCTCACCGCGCT
CCGCCGCCCTACAACATGGCTGGAGTCCCCATGGCTCCATCTCCTGCTCTGCCAGGCCGTGGCGCTGCTCCTCTC
CCTCCTGCACCCCAAGGCCTTCCCGCTCGCCCTCCTCACGCTCAGCCCGGTTTCCCACGCCCACCCGATTACCAC
CTCGGCAATTTTCATCCGCCCAATTCATCGCCCGTTCCACAAGGCTTTCCCATTGGTCCTCCTCCTCCTGGCTTC
CCGGCCCCTCCTCCTGTTGGTGCAGCATCTCCCCCCGTCATGCCTCCCGGTTTTCAGCCTCCGCCTGGCTTCCAG
CCCCCGCCGGGCTATCATCGCCGTTGA
Transcript >OphauB2|1677
ATGGCTCAGAACCGACATTGGGAGCAGGACAAGGAGGCGACAGTATACGTGGGAAACATTGATGAGCGCGTCACT
CCGGCTGTCCTGTACGAAATAATGGTGCAAATGGGCCCGGTGCACAACCTGCACATGCCGCGCGATCGCATCACG
CAGAACCACCAGGGATTTGGCTTTGTCGAGTTTCGCGGCCCCCAAGACGCCGACTATGCCGCTGCCATTATGAAT
GGCATCAAGCTGTTTGGCAAGCCCATTCGCGTCAACAAGGCCAGCGCTGACAAGCAAAAAGCGGCTGATGTCGGC
GCCATTCTATTTGTTGGAAATCTCGATCAAATGGTGGACGAAAAGATTCTCTGCGACACCTTTTGCCGCTTTGGA
ACCCTTCTCTCCGTGCCCAAGATTATGCGCGACGACGAGGGCAACAGCAAATGCTACGCTTTTGTCAGCTTTGCC
GACTTTGACAGCAGCGACAATGCCATCAACAACATCCAAGGACAGTACATTCTCAGCAAGCAGGCTGTCGTCGAG
TACGCCCTCAAAAAGGATGGCCGTGGCGAGCGTCACGGAGACGAGGCTGAGCGCCAGCTGGCAGCTCAGGCCAAG
TTGCGCGACATCGTCCCCGAGGCCCAGCCCATCCCCCAGGCCTTCTTGCAACAGGGCCCGTCTCTGGGTGCCGTC
AATCCTGCTGCTGCTCCCCCTGCCATGCCCAATGCCGCTCCCGTGCCCCCGGCTGGTTTCGATGCTTCAGCAATG
CCTCTAGCCGCCTCCCCCGCCGCCGCGGCTTCTCATGGCATGCCCAGCGGCTTTGTACCGCCGCCTCACCGCGCT
CCGCCGCCCTACAACATGGCTGGAGTCCCCATGGCTCCATCTCCTGCTCTGCCAGGCCGTGGCGCTGCTCCTCTC
CCTCCTGCACCCCAAGGCCTTCCCGCTCGCCCTCCTCACGCTCAGCCCGGTTTCCCACGCCCACCCGATTACCAC
CTCGGCAATTTTCATCCGCCCAATTCATCGCCCGTTCCACAAGGCTTTCCCATTGGTCCTCCTCCTCCTGGCTTC
CCGGCCCCTCCTCCTGTTGGTGCAGCATCTCCCCCCGTCATGCCTCCCGGTTTTCAGCCTCCGCCTGGCTTCCAG
CCCCCGCCGGGCTATCATCGCCGTTGA
Gene >OphauB2|1677
ATGGCTCAGAACCGACATTGGTATGCCCCCTCTGCTCGACTCAGACGCCCGCCCCCTTGGTCCGTCGTCAGAATT
CTTACAGCCCCCACAGGGAGCAGGACAAGGAGGCGACAGTATACGTGGGAAACATTGATGAGCGCGTCACTCCGG
CTGTCCTGTACGAAATAATGGTGCAAATGGGCCCGGTGCACAACCTGCACATGCCGCGCGATCGCATCACGCAGA
ACCACCAGGGATTTGGCTTTGTCGAGTTTCGCGGCCCCCAAGACGCCGACTATGCCGCTGCCATTATGAATGGCA
TCAAGCTGTTTGGCAAGCCCATTCGCGTCAACAAGGCCAGCGCTGACAAGCAAAAAGCGGCTGATGTCGGCGCCA
TTCTATTTGTTGGAAATCTCGATCAAATGGTGGACGAAAAGATTCTCTGCGACACCTTTTGCCGCTTTGGAACCC
TTCTCTCCGTGCCCAAGATTATGCGCGACGACGAGGGCAACAGCAAATGCTACGCTTTTGTCAGCTTTGCCGACT
TTGACAGCAGCGACAATGCCATCAACAACATCCAAGGACAGTACATTCTCAGCAAGCAGGCTGTCGTCGAGTACG
CCCTCAAAAAGGATGGCCGTGGCGAGCGTCACGGAGACGAGGCTGAGCGCCAGCTGGCAGCTCAGGCCAAGTTGC
GCGACATCGTCCCCGAGGCCCAGCCCATCCCCCAGGCCTTCTTGCAACAGGGCCCGTCTCTGGGTGCCGTCAATC
CTGCTGCTGCTCCCCCTGCCATGCCCAATGCCGCTCCCGTGCCCCCGGCTGGTTTCGATGCTTCAGCAATGCCTC
TAGCCGCCTCCCCCGCCGCCGCGGCTTCTCATGGCATGCCCAGCGGCTTTGTACCGCCGCCTCACCGCGCTCCGC
CGCCCTACAACATGGCTGGAGTCCCCATGGCTCCATCTCCTGCTCTGCCAGGCCGTGGCGCTGCTCCTCTCCCTC
CTGCACCCCAAGGCCTTCCCGCTCGCCCTCCTCACGCTCAGCCCGGTTTCCCACGCCCACCCGATTACCACCTCG
GCAATTTTCATCCGCCCAATTCATCGCCCGTTCCACAAGGCTTTCCCATTGGTCCTCCTCCTCCTGGCTTCCCGG
CCCCTCCTCCTGTTGGTGCAGCATCTCCCCCCGTCATGCCTCCCGGTTTTCAGCCTCCGCCTGGCTTCCAGCCCC
CGCCGGGCTATCATCGCCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail