Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1669
Gene name
LocationContig_147:16074..19156
Strand-
Gene length (bp)3082
Transcript length (bp)3021
Coding sequence length (bp)3021
Protein length (aa) 1007

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31 1.3E-142 408 855
PF13802 Gal_mutarotas_2 Galactose mutarotase-like 9.4E-25 299 373

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 153 1006 0.0E+00
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 19 952 0.0E+00
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 239 928 0.0E+00
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 29 917 0.0E+00
sp|B9F676|GLU2A_ORYSJ Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica GN=Os03g0216600 PE=3 SV=1 28 1006 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 153 1006 0.0E+00
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 19 952 0.0E+00
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 239 928 0.0E+00
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 29 917 0.0E+00
sp|B9F676|GLU2A_ORYSJ Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica GN=Os03g0216600 PE=3 SV=1 28 1006 0.0E+00
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 8 920 0.0E+00
sp|Q9FN05|PSL5_ARATH Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana GN=PSL5 PE=1 SV=1 13 952 0.0E+00
sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus GN=Ganab PE=1 SV=1 10 1005 0.0E+00
sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3 10 1005 0.0E+00
sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fascicularis GN=GANAB PE=2 SV=1 10 1005 0.0E+00
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa GN=GANAB PE=1 SV=1 10 1005 0.0E+00
sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1 14 953 0.0E+00
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens PE=3 SV=1 296 925 2.0E-113
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1 324 897 4.0E-89
sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=4 299 953 4.0E-88
sp|Q9MYM4|LYAG_BOVIN Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1 299 917 1.0E-85
sp|Q5R7A9|LYAG_PONAB Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA PE=2 SV=1 299 953 3.0E-85
sp|Q6P7A9|LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1 299 932 2.0E-83
sp|P70699|LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2 299 917 3.0E-82
sp|Q43763|AGLU_HORVU Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1 300 901 4.0E-82
sp|O04893|AGLU_SPIOL Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1 298 952 1.0E-79
sp|O04931|AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1 296 991 6.0E-79
sp|F4J6T7|XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana GN=XYL2 PE=5 SV=1 324 962 5.0E-75
sp|Q9S7Y7|XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana GN=XYL1 PE=1 SV=1 324 976 6.0E-70
sp|P0CD66|AGLU_SULSO Alpha-glucosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=malA PE=1 SV=1 299 855 1.0E-66
sp|D0KQM8|AGLU_SULS9 Alpha-glucosidase OS=Sulfolobus solfataricus (strain 98/2) GN=malA PE=1 SV=1 299 855 1.0E-66
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 345 925 1.0E-65
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 342 925 4.0E-65
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 345 917 2.0E-64
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 345 919 3.0E-63
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 344 917 4.0E-63
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 339 938 9.0E-63
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 339 918 6.0E-61
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 403 899 1.0E-60
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 339 917 2.0E-59
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 339 938 7.0E-56
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 342 919 8.0E-56
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 345 925 6.0E-54
sp|O74254|AMYG_CANAL Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAM1 PE=1 SV=2 613 917 6.0E-49
sp|Q09901|YAJ1_SCHPO Uncharacterized family 31 glucosidase C30D11.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.01c PE=3 SV=2 600 897 2.0E-48
sp|Q9P999|XYLS_SULSO Alpha-xylosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=xylS PE=1 SV=1 398 905 3.0E-48
sp|O00906|AGLU_TETPY Lysosomal acid alpha-glucosidase OS=Tetrahymena pyriformis PE=1 SV=1 403 892 4.0E-48
sp|Q0CMA7|AGDC_ASPTN Probable alpha/beta-glucosidase agdC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=agdC PE=3 SV=1 598 955 2.0E-47
sp|Q9URX4|YFZB_SCHPO Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.11c PE=3 SV=1 613 918 7.0E-46
sp|Q92442|AGLU_MUCJA Alpha-glucosidase OS=Mucor javanicus PE=1 SV=1 593 899 2.0E-45
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 604 912 1.0E-44
sp|A1CNK4|AGDC_ASPCL Probable alpha/beta-glucosidase agdC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=agdC PE=3 SV=1 598 898 1.0E-44
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 604 912 1.0E-44
sp|Q9C0Y4|AGLU_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agl1 PE=1 SV=2 600 931 6.0E-44
sp|B0XNL6|AGDC_ASPFC Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=agdC PE=3 SV=1 598 899 2.0E-43
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 598 899 2.0E-43
sp|A1D1E6|AGDC_NEOFI Probable alpha/beta-glucosidase agdC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=agdC PE=3 SV=1 598 900 8.0E-43
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=aglA PE=1 SV=1 605 898 2.0E-42
sp|P22861|AMYG_SCHOC Glucoamylase 1 OS=Schwanniomyces occidentalis GN=GAM1 PE=1 SV=1 613 898 3.0E-42
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdA PE=2 SV=1 602 897 5.0E-41
sp|B3PEE6|OL4AG_CELJU Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=agd31B PE=1 SV=1 383 895 5.0E-40
sp|D4B0X3|AGD1_ARTBC Probable alpha/beta-glucosidase ARB_02101 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02101 PE=1 SV=1 656 900 4.0E-39
sp|Q5AWI5|AGDC_EMENI Alpha/beta-glucosidase agdC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdC PE=2 SV=2 598 900 1.0E-37
sp|A7LXT0|GH31A_BACO1 Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02646 PE=1 SV=1 398 916 7.0E-32
sp|Q5AW25|AGDD_EMENI Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdD PE=1 SV=1 405 855 3.0E-31
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis PE=1 SV=1 613 895 6.0E-31
sp|Q5AWI5|AGDC_EMENI Alpha/beta-glucosidase agdC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdC PE=2 SV=2 286 592 1.0E-27
sp|D4B0X3|AGD1_ARTBC Probable alpha/beta-glucosidase ARB_02101 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02101 PE=1 SV=1 299 592 2.0E-27
sp|Q0CMA7|AGDC_ASPTN Probable alpha/beta-glucosidase agdC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=agdC PE=3 SV=1 299 592 1.0E-26
sp|Q01336|YCR2_ESCVU Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Escherichia vulneris PE=3 SV=1 346 726 4.0E-26
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 299 601 5.0E-26
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 299 601 7.0E-26
sp|A1CNK4|AGDC_ASPCL Probable alpha/beta-glucosidase agdC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=agdC PE=3 SV=1 299 592 2.0E-25
sp|Q92442|AGLU_MUCJA Alpha-glucosidase OS=Mucor javanicus PE=1 SV=1 318 592 2.0E-25
sp|B0XNL6|AGDC_ASPFC Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=agdC PE=3 SV=1 299 592 4.0E-25
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 299 592 4.0E-25
sp|A1D1E6|AGDC_NEOFI Probable alpha/beta-glucosidase agdC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=agdC PE=3 SV=1 299 592 4.0E-25
sp|P31434|XYLS_ECOLI Alpha-xylosidase OS=Escherichia coli (strain K12) GN=yicI PE=1 SV=2 401 817 4.0E-25
sp|O74254|AMYG_CANAL Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAM1 PE=1 SV=2 344 592 7.0E-23
sp|A2QTU5|XYLA_ASPNC Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=axlA PE=1 SV=1 385 852 2.0E-19
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis PE=1 SV=1 414 599 2.0E-18
sp|P22861|AMYG_SCHOC Glucoamylase 1 OS=Schwanniomyces occidentalis GN=GAM1 PE=1 SV=1 398 592 3.0E-18
sp|Q9C0Y4|AGLU_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agl1 PE=1 SV=2 403 592 6.0E-18
sp|Q9URX4|YFZB_SCHPO Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.11c PE=3 SV=1 345 592 6.0E-17
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=aglA PE=1 SV=1 398 592 7.0E-17
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdA PE=2 SV=1 398 592 5.0E-14
sp|Q09901|YAJ1_SCHPO Uncharacterized family 31 glucosidase C30D11.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.01c PE=3 SV=2 393 592 5.0E-13
sp|Q69ZQ1|K1161_MOUSE Uncharacterized family 31 glucosidase KIAA1161 OS=Mus musculus GN=Kiaa1161 PE=1 SV=2 546 818 2.0E-11
sp|Q6NSJ0|K1161_HUMAN Uncharacterized family 31 glucosidase KIAA1161 OS=Homo sapiens GN=KIAA1161 PE=1 SV=2 632 818 6.0E-11
sp|P19965|SP15_TORCA SITS-binding protein OS=Torpedo californica PE=1 SV=2 664 859 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1669
MRPAPARLLNWAALLCCLAALVCLIQPADAVKEHDFKKCKQSGFCQRNRDYADRAEDYSSTWSSPYRIVPESVAL
QEGKLQAMVLKTLNANGETARFPLTVSFLKSGLSRVTMDEERRQKGDIELRHNSHVRKERYNEVDRWAIVGGLEL
DPKAQIVSQDQSQMIIKYGPDSATEAFIKFSPFQMDFRRNGETHIKFNSRGLLNMEHWRPKVDKPQGQESGDEDK
SENQDAGAESQPENQESASENKPEDGNQDGNQDGNQDGEDESTWWDESFGGNTDSKPRGPESVALDISFLEYGHV
YGIPEHTGPMSLKPTRGGFNDYLDPYRMYNSDVFEYILDSPMTLYGSIPFMQAHRKGSSVGVFWLNAAETWVDIV
KTKDEAKSTASGSTAKTSTHTHWISENGLLDVFVLMGPTPSDLTHRYGELTGYTTLPPEFSIGYHQCRWNYISDE
DLRDVDRKMDKFNVPYDVIWLDIEYTEDRKYFTWEPNSFPDPITTGQLLDMHGRKLVVIIDPHIKKLDTYVVSQQ
LTSQDLAVHNKDDEIYEGWCWPGSSNWVDCFNPKANEWWKTLFKYKFFNGTMENTFLWNDMNEPSVFNGPETTMP
KDNIHFGNWEHRDVHNLNGLTFHKASYDAMISRKEGERQRPFILTRSFYAGSQRLGAMWTGDNQASWDHLAASIP
MILNLGISGYPFAGADVGGFFGNPERDLMARWYQAGAFYPFFRGHAHIDSRRREPYLLPTPYRQIITTALRLRYS
LLPSWYTAFFQASKDGSPIVRPMFWTHPDMEGGFAIDDQFFLGSTGLLVKPIVEKDQVSTEVWIPDGESYFDYKT
YHVMQTEAGKNITVKAEIDEIPLLMRGGHIFARRDIPRRSSAAMRFDDYTLMVVVAKNGRAEGELYTDDGSSFDH
GDGQYIHRKFVLEENTLSSLDAAKGQQGGPVEAGDWLKGMAGVSVDRIIVVGAPAIWDRDEVEIVSKSRTWSIKV
KYYKADKERAAFAVLGRVGAAIEDDWSIRLG*
Coding >OphauB2|1669
ATGAGGCCGGCACCAGCGCGGTTATTGAATTGGGCAGCGCTTCTTTGCTGCTTGGCAGCATTGGTATGCTTGATT
CAACCAGCAGATGCGGTCAAGGAGCACGACTTTAAAAAGTGCAAACAATCTGGTTTCTGTCAGCGCAATCGGGAC
TATGCCGACAGAGCCGAGGACTATAGCTCAACATGGAGCTCGCCATATCGAATAGTACCCGAATCAGTGGCCCTT
CAAGAAGGAAAGCTGCAGGCCATGGTACTCAAGACACTTAATGCCAATGGAGAAACGGCACGATTTCCATTGACG
GTGTCGTTTTTGAAAAGTGGACTGTCGCGGGTCACCATGGACGAGGAAAGACGGCAAAAGGGAGACATTGAGCTA
CGGCATAACAGTCATGTGCGGAAAGAGCGCTACAATGAAGTTGATAGGTGGGCTATTGTTGGCGGCTTGGAGCTG
GACCCAAAGGCACAGATTGTGTCGCAGGACCAGTCGCAGATGATTATCAAGTACGGTCCAGACTCTGCCACTGAG
GCTTTCATCAAGTTTTCGCCATTTCAGATGGACTTTCGGCGTAATGGAGAAACACACATCAAGTTTAATAGCCGC
GGCCTCCTCAATATGGAGCACTGGCGACCCAAGGTGGACAAGCCTCAGGGTCAAGAGAGCGGTGACGAAGACAAG
TCTGAGAACCAAGACGCTGGAGCCGAATCTCAGCCTGAGAACCAAGAGAGTGCAAGTGAGAACAAGCCCGAAGAT
GGAAATCAGGACGGGAATCAGGACGGGAACCAAGACGGCGAGGATGAGAGCACTTGGTGGGACGAGTCATTTGGT
GGAAACACCGACTCAAAGCCCCGCGGCCCAGAAAGTGTTGCACTGGACATTTCCTTTTTGGAATACGGTCACGTC
TACGGCATACCCGAGCACACTGGGCCCATGTCCTTGAAGCCGACGCGTGGCGGATTCAACGATTATTTGGACCCT
TACCGGATGTACAACTCCGACGTCTTTGAGTATATCCTCGACAGCCCAATGACCCTGTATGGCTCGATTCCGTTT
ATGCAGGCACATCGCAAGGGCTCCTCTGTCGGCGTTTTTTGGCTCAATGCAGCGGAAACATGGGTCGATATTGTC
AAGACCAAGGACGAGGCCAAAAGCACGGCAAGTGGCTCTACAGCCAAGACCAGCACGCACACTCACTGGATTTCT
GAAAACGGGTTGCTTGATGTCTTTGTCCTGATGGGACCGACACCTAGTGATTTGACCCATCGATATGGCGAGCTT
ACAGGCTATACAACATTGCCGCCAGAGTTTTCTATTGGCTATCATCAATGCCGCTGGAATTACATTTCAGACGAA
GATCTCCGAGATGTTGATCGCAAGATGGACAAGTTCAATGTCCCTTACGATGTTATTTGGCTCGATATAGAGTAC
ACTGAAGACCGCAAGTACTTTACCTGGGAGCCAAATTCGTTCCCGGATCCCATCACGACAGGGCAGCTGCTTGAC
ATGCATGGCAGAAAGCTTGTGGTCATTATCGATCCTCACATCAAGAAGCTGGACACATATGTAGTCAGCCAGCAA
CTAACGTCTCAAGACCTCGCTGTTCATAACAAGGATGACGAAATCTACGAGGGGTGGTGCTGGCCAGGTTCGTCC
AACTGGGTCGACTGCTTCAATCCCAAGGCGAATGAATGGTGGAAGACGCTGTTCAAGTACAAGTTTTTCAACGGA
ACCATGGAAAACACATTTCTTTGGAACGACATGAATGAGCCGTCCGTCTTCAACGGCCCGGAAACGACAATGCCC
AAGGATAATATCCATTTCGGAAACTGGGAACACCGAGATGTCCACAACCTCAACGGACTAACCTTCCACAAGGCC
AGCTACGATGCCATGATTTCGCGCAAGGAGGGTGAACGGCAACGGCCCTTTATTCTCACACGCTCGTTTTACGCC
GGGTCGCAGAGACTGGGTGCCATGTGGACGGGCGACAATCAGGCTTCCTGGGACCATCTTGCCGCTTCCATCCCC
ATGATACTGAACCTGGGTATCTCTGGATACCCCTTTGCTGGGGCCGATGTCGGCGGCTTCTTTGGCAATCCGGAA
CGGGATTTAATGGCACGCTGGTACCAGGCTGGCGCATTTTACCCCTTTTTCCGAGGGCACGCTCATATTGACTCG
CGACGACGTGAGCCATATCTGCTGCCAACGCCATATCGGCAAATCATCACAACAGCCTTGCGCTTGCGCTACTCG
CTGCTGCCATCATGGTACACTGCATTTTTCCAGGCGTCCAAGGATGGCAGTCCTATTGTGCGGCCCATGTTTTGG
ACGCACCCAGACATGGAAGGGGGCTTTGCCATTGACGATCAGTTTTTCCTTGGTTCCACAGGCTTGCTGGTCAAG
CCGATTGTGGAAAAAGACCAGGTGTCAACCGAGGTGTGGATTCCTGATGGCGAGTCGTACTTTGATTACAAGACA
TACCATGTGATGCAGACGGAAGCTGGCAAAAACATAACAGTCAAGGCGGAAATAGACGAGATTCCGCTGCTCATG
CGAGGAGGCCATATTTTTGCGCGCCGCGACATTCCGCGACGGTCAAGCGCGGCGATGCGGTTTGACGATTACACG
CTCATGGTGGTGGTTGCCAAAAACGGCAGAGCAGAGGGCGAGCTGTACACGGATGATGGCAGCTCATTTGACCAT
GGCGACGGACAGTACATTCACCGCAAGTTTGTCTTGGAGGAAAACACGCTGTCATCTCTTGATGCCGCCAAGGGC
CAACAAGGGGGGCCTGTCGAGGCTGGTGACTGGCTCAAGGGGATGGCTGGTGTGTCTGTGGACAGGATCATCGTT
GTGGGTGCACCGGCCATATGGGACAGGGACGAGGTAGAGATTGTGTCCAAATCACGAACCTGGAGCATCAAGGTA
AAGTACTACAAAGCCGACAAGGAGCGGGCTGCGTTTGCAGTACTCGGGCGGGTGGGAGCTGCTATTGAGGATGAC
TGGAGCATAAGGCTCGGTTGA
Transcript >OphauB2|1669
ATGAGGCCGGCACCAGCGCGGTTATTGAATTGGGCAGCGCTTCTTTGCTGCTTGGCAGCATTGGTATGCTTGATT
CAACCAGCAGATGCGGTCAAGGAGCACGACTTTAAAAAGTGCAAACAATCTGGTTTCTGTCAGCGCAATCGGGAC
TATGCCGACAGAGCCGAGGACTATAGCTCAACATGGAGCTCGCCATATCGAATAGTACCCGAATCAGTGGCCCTT
CAAGAAGGAAAGCTGCAGGCCATGGTACTCAAGACACTTAATGCCAATGGAGAAACGGCACGATTTCCATTGACG
GTGTCGTTTTTGAAAAGTGGACTGTCGCGGGTCACCATGGACGAGGAAAGACGGCAAAAGGGAGACATTGAGCTA
CGGCATAACAGTCATGTGCGGAAAGAGCGCTACAATGAAGTTGATAGGTGGGCTATTGTTGGCGGCTTGGAGCTG
GACCCAAAGGCACAGATTGTGTCGCAGGACCAGTCGCAGATGATTATCAAGTACGGTCCAGACTCTGCCACTGAG
GCTTTCATCAAGTTTTCGCCATTTCAGATGGACTTTCGGCGTAATGGAGAAACACACATCAAGTTTAATAGCCGC
GGCCTCCTCAATATGGAGCACTGGCGACCCAAGGTGGACAAGCCTCAGGGTCAAGAGAGCGGTGACGAAGACAAG
TCTGAGAACCAAGACGCTGGAGCCGAATCTCAGCCTGAGAACCAAGAGAGTGCAAGTGAGAACAAGCCCGAAGAT
GGAAATCAGGACGGGAATCAGGACGGGAACCAAGACGGCGAGGATGAGAGCACTTGGTGGGACGAGTCATTTGGT
GGAAACACCGACTCAAAGCCCCGCGGCCCAGAAAGTGTTGCACTGGACATTTCCTTTTTGGAATACGGTCACGTC
TACGGCATACCCGAGCACACTGGGCCCATGTCCTTGAAGCCGACGCGTGGCGGATTCAACGATTATTTGGACCCT
TACCGGATGTACAACTCCGACGTCTTTGAGTATATCCTCGACAGCCCAATGACCCTGTATGGCTCGATTCCGTTT
ATGCAGGCACATCGCAAGGGCTCCTCTGTCGGCGTTTTTTGGCTCAATGCAGCGGAAACATGGGTCGATATTGTC
AAGACCAAGGACGAGGCCAAAAGCACGGCAAGTGGCTCTACAGCCAAGACCAGCACGCACACTCACTGGATTTCT
GAAAACGGGTTGCTTGATGTCTTTGTCCTGATGGGACCGACACCTAGTGATTTGACCCATCGATATGGCGAGCTT
ACAGGCTATACAACATTGCCGCCAGAGTTTTCTATTGGCTATCATCAATGCCGCTGGAATTACATTTCAGACGAA
GATCTCCGAGATGTTGATCGCAAGATGGACAAGTTCAATGTCCCTTACGATGTTATTTGGCTCGATATAGAGTAC
ACTGAAGACCGCAAGTACTTTACCTGGGAGCCAAATTCGTTCCCGGATCCCATCACGACAGGGCAGCTGCTTGAC
ATGCATGGCAGAAAGCTTGTGGTCATTATCGATCCTCACATCAAGAAGCTGGACACATATGTAGTCAGCCAGCAA
CTAACGTCTCAAGACCTCGCTGTTCATAACAAGGATGACGAAATCTACGAGGGGTGGTGCTGGCCAGGTTCGTCC
AACTGGGTCGACTGCTTCAATCCCAAGGCGAATGAATGGTGGAAGACGCTGTTCAAGTACAAGTTTTTCAACGGA
ACCATGGAAAACACATTTCTTTGGAACGACATGAATGAGCCGTCCGTCTTCAACGGCCCGGAAACGACAATGCCC
AAGGATAATATCCATTTCGGAAACTGGGAACACCGAGATGTCCACAACCTCAACGGACTAACCTTCCACAAGGCC
AGCTACGATGCCATGATTTCGCGCAAGGAGGGTGAACGGCAACGGCCCTTTATTCTCACACGCTCGTTTTACGCC
GGGTCGCAGAGACTGGGTGCCATGTGGACGGGCGACAATCAGGCTTCCTGGGACCATCTTGCCGCTTCCATCCCC
ATGATACTGAACCTGGGTATCTCTGGATACCCCTTTGCTGGGGCCGATGTCGGCGGCTTCTTTGGCAATCCGGAA
CGGGATTTAATGGCACGCTGGTACCAGGCTGGCGCATTTTACCCCTTTTTCCGAGGGCACGCTCATATTGACTCG
CGACGACGTGAGCCATATCTGCTGCCAACGCCATATCGGCAAATCATCACAACAGCCTTGCGCTTGCGCTACTCG
CTGCTGCCATCATGGTACACTGCATTTTTCCAGGCGTCCAAGGATGGCAGTCCTATTGTGCGGCCCATGTTTTGG
ACGCACCCAGACATGGAAGGGGGCTTTGCCATTGACGATCAGTTTTTCCTTGGTTCCACAGGCTTGCTGGTCAAG
CCGATTGTGGAAAAAGACCAGGTGTCAACCGAGGTGTGGATTCCTGATGGCGAGTCGTACTTTGATTACAAGACA
TACCATGTGATGCAGACGGAAGCTGGCAAAAACATAACAGTCAAGGCGGAAATAGACGAGATTCCGCTGCTCATG
CGAGGAGGCCATATTTTTGCGCGCCGCGACATTCCGCGACGGTCAAGCGCGGCGATGCGGTTTGACGATTACACG
CTCATGGTGGTGGTTGCCAAAAACGGCAGAGCAGAGGGCGAGCTGTACACGGATGATGGCAGCTCATTTGACCAT
GGCGACGGACAGTACATTCACCGCAAGTTTGTCTTGGAGGAAAACACGCTGTCATCTCTTGATGCCGCCAAGGGC
CAACAAGGGGGGCCTGTCGAGGCTGGTGACTGGCTCAAGGGGATGGCTGGTGTGTCTGTGGACAGGATCATCGTT
GTGGGTGCACCGGCCATATGGGACAGGGACGAGGTAGAGATTGTGTCCAAATCACGAACCTGGAGCATCAAGGTA
AAGTACTACAAAGCCGACAAGGAGCGGGCTGCGTTTGCAGTACTCGGGCGGGTGGGAGCTGCTATTGAGGATGAC
TGGAGCATAAGGCTCGGTTGA
Gene >OphauB2|1669
ATGAGGCCGGCACCAGCGCGGTTATTGAATTGGGCAGCGCTTCTTTGCTGCTTGGCAGCATTGGTATGCTTGATT
CAACCAGCAGGTCTGTCCAGACACTCCAACTATGCTCGACTCAAGCGACACCAATCACTGACATTCTCCAGATGC
GGTCAAGGAGCACGACTTTAAAAAGTGCAAACAATCTGGTTTCTGTCAGCGCAATCGGGACTATGCCGACAGAGC
CGAGGACTATAGCTCAACATGGAGCTCGCCATATCGAATAGTACCCGAATCAGTGGCCCTTCAAGAAGGAAAGCT
GCAGGCCATGGTACTCAAGACACTTAATGCCAATGGAGAAACGGCACGATTTCCATTGACGGTGTCGTTTTTGAA
AAGTGGACTGTCGCGGGTCACCATGGACGAGGAAAGACGGCAAAAGGGAGACATTGAGCTACGGCATAACAGTCA
TGTGCGGAAAGAGCGCTACAATGAAGTTGATAGGTGGGCTATTGTTGGCGGCTTGGAGCTGGACCCAAAGGCACA
GATTGTGTCGCAGGACCAGTCGCAGATGATTATCAAGTACGGTCCAGACTCTGCCACTGAGGCTTTCATCAAGTT
TTCGCCATTTCAGATGGACTTTCGGCGTAATGGAGAAACACACATCAAGTTTAATAGCCGCGGCCTCCTCAATAT
GGAGCACTGGCGACCCAAGGTGGACAAGCCTCAGGGTCAAGAGAGCGGTGACGAAGACAAGTCTGAGAACCAAGA
CGCTGGAGCCGAATCTCAGCCTGAGAACCAAGAGAGTGCAAGTGAGAACAAGCCCGAAGATGGAAATCAGGACGG
GAATCAGGACGGGAACCAAGACGGCGAGGATGAGAGCACTTGGTGGGACGAGTCATTTGGTGGAAACACCGACTC
AAAGCCCCGCGGCCCAGAAAGTGTTGCACTGGACATTTCCTTTTTGGAATACGGTCACGTCTACGGCATACCCGA
GCACACTGGGCCCATGTCCTTGAAGCCGACGCGTGGCGGATTCAACGATTATTTGGACCCTTACCGGATGTACAA
CTCCGACGTCTTTGAGTATATCCTCGACAGCCCAATGACCCTGTATGGCTCGATTCCGTTTATGCAGGCACATCG
CAAGGGCTCCTCTGTCGGCGTTTTTTGGCTCAATGCAGCGGAAACATGGGTCGATATTGTCAAGACCAAGGACGA
GGCCAAAAGCACGGCAAGTGGCTCTACAGCCAAGACCAGCACGCACACTCACTGGATTTCTGAAAACGGGTTGCT
TGATGTCTTTGTCCTGATGGGACCGACACCTAGTGATTTGACCCATCGATATGGCGAGCTTACAGGCTATACAAC
ATTGCCGCCAGAGTTTTCTATTGGCTATCATCAATGCCGCTGGAATTACATTTCAGACGAAGATCTCCGAGATGT
TGATCGCAAGATGGACAAGTTCAATGTCCCTTACGATGTTATTTGGCTCGATATAGAGTACACTGAAGACCGCAA
GTACTTTACCTGGGAGCCAAATTCGTTCCCGGATCCCATCACGACAGGGCAGCTGCTTGACATGCATGGCAGAAA
GCTTGTGGTCATTATCGATCCTCACATCAAGAAGCTGGACACATATGTAGTCAGCCAGCAACTAACGTCTCAAGA
CCTCGCTGTTCATAACAAGGATGACGAAATCTACGAGGGGTGGTGCTGGCCAGGTTCGTCCAACTGGGTCGACTG
CTTCAATCCCAAGGCGAATGAATGGTGGAAGACGCTGTTCAAGTACAAGTTTTTCAACGGAACCATGGAAAACAC
ATTTCTTTGGAACGACATGAATGAGCCGTCCGTCTTCAACGGCCCGGAAACGACAATGCCCAAGGATAATATCCA
TTTCGGAAACTGGGAACACCGAGATGTCCACAACCTCAACGGACTAACCTTCCACAAGGCCAGCTACGATGCCAT
GATTTCGCGCAAGGAGGGTGAACGGCAACGGCCCTTTATTCTCACACGCTCGTTTTACGCCGGGTCGCAGAGACT
GGGTGCCATGTGGACGGGCGACAATCAGGCTTCCTGGGACCATCTTGCCGCTTCCATCCCCATGATACTGAACCT
GGGTATCTCTGGATACCCCTTTGCTGGGGCCGATGTCGGCGGCTTCTTTGGCAATCCGGAACGGGATTTAATGGC
ACGCTGGTACCAGGCTGGCGCATTTTACCCCTTTTTCCGAGGGCACGCTCATATTGACTCGCGACGACGTGAGCC
ATATCTGCTGCCAACGCCATATCGGCAAATCATCACAACAGCCTTGCGCTTGCGCTACTCGCTGCTGCCATCATG
GTACACTGCATTTTTCCAGGCGTCCAAGGATGGCAGTCCTATTGTGCGGCCCATGTTTTGGACGCACCCAGACAT
GGAAGGGGGCTTTGCCATTGACGATCAGTTTTTCCTTGGTTCCACAGGCTTGCTGGTCAAGCCGATTGTGGAAAA
AGACCAGGTGTCAACCGAGGTGTGGATTCCTGATGGCGAGTCGTACTTTGATTACAAGACATACCATGTGATGCA
GACGGAAGCTGGCAAAAACATAACAGTCAAGGCGGAAATAGACGAGATTCCGCTGCTCATGCGAGGAGGCCATAT
TTTTGCGCGCCGCGACATTCCGCGACGGTCAAGCGCGGCGATGCGGTTTGACGATTACACGCTCATGGTGGTGGT
TGCCAAAAACGGCAGAGCAGAGGGCGAGCTGTACACGGATGATGGCAGCTCATTTGACCATGGCGACGGACAGTA
CATTCACCGCAAGTTTGTCTTGGAGGAAAACACGCTGTCATCTCTTGATGCCGCCAAGGGCCAACAAGGGGGGCC
TGTCGAGGCTGGTGACTGGCTCAAGGGGATGGCTGGTGTGTCTGTGGACAGGATCATCGTTGTGGGTGCACCGGC
CATATGGGACAGGGACGAGGTAGAGATTGTGTCCAAATCACGAACCTGGAGCATCAAGGTAAAGTACTACAAAGC
CGACAAGGAGCGGGCTGCGTTTGCAGTACTCGGGCGGGTGGGAGCTGCTATTGAGGATGACTGGAGCATAAGGCT
CGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail