Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1666
Gene name
LocationContig_147:4434..5845
Strand-
Gene length (bp)1411
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14378 PAP2_3 PAP2 superfamily 2.0E-29 161 378

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 116 138 22
3 194 213 19
4 247 264 17
5 306 328 22
6 341 363 22
7 368 390 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1666
MAVGAFLEPLVVVTLLFGGAWVNRNKEYKFWGGKQSAGWTGEARIKRSDDLMGLDARRESEDSLLSRDDWSGSST
PTLAPNDVSTTRRRKLRFFGYQRLVSTPNTLVFKDRFLSRVLQKFPFLAEAWYWALIYWVYQLGRAFTALSLVEG
TVHVARKHALQLIHLEQRLGIFWEVPIQQWFIARPLLMHWTNRVYSFIHIPGTIFFLVFLYYLTTTRKRSMGNAG
TKVAAGPALYEARRRTMAMCNLLAFVVFTLWPCMPPRLLSDAEYTGDNAAEAKSYGFVDTVHGADGESSVWTTNR
FCNQYAAMPSLHFGYSLLIGLTVATLPISGLRPMSWKRMAIVAVGMAYPALILTAIVATANHFILDAVAGAVVCG
VAWHANQVLLNLCIVEDYFLWLLRMHKPVNYTDPDTAVEPELPATLLMSEEV*
Coding >OphauB2|1666
ATGGCTGTGGGTGCCTTTCTCGAGCCACTGGTTGTGGTGACGCTTCTCTTTGGCGGAGCTTGGGTCAACCGCAAC
AAGGAGTACAAGTTTTGGGGCGGCAAACAGTCAGCAGGCTGGACTGGCGAAGCTAGAATAAAGCGCAGCGACGAC
TTGATGGGCCTCGACGCCAGACGCGAATCCGAGGACAGCCTTCTCTCGAGAGACGACTGGAGCGGCAGCTCGACG
CCGACGCTGGCGCCCAACGACGTGTCGACGACGCGCCGCCGCAAGCTGCGATTTTTTGGCTACCAGCGCCTTGTC
TCGACACCAAATACCCTTGTCTTCAAGGACCGATTTCTGAGCCGCGTCCTGCAAAAGTTTCCCTTTCTTGCCGAA
GCCTGGTACTGGGCCCTGATTTACTGGGTTTACCAGCTGGGCCGTGCCTTTACCGCCCTGTCGCTGGTGGAGGGA
ACGGTGCACGTGGCGCGCAAACACGCGCTGCAGCTCATCCATCTCGAGCAGCGGCTGGGCATCTTTTGGGAGGTG
CCGATTCAGCAATGGTTCATTGCGCGCCCCCTGCTGATGCACTGGACCAACCGCGTCTACTCGTTTATCCATATT
CCCGGCACCATCTTCTTCCTCGTCTTCCTCTACTACTTGACGACGACACGCAAGCGGTCAATGGGCAATGCGGGC
ACCAAGGTGGCGGCGGGGCCGGCTCTATACGAGGCGCGGCGTCGCACCATGGCCATGTGCAACCTGCTGGCCTTT
GTCGTCTTCACGCTGTGGCCCTGCATGCCGCCGCGGCTGCTGAGCGATGCCGAGTACACGGGCGACAATGCGGCA
GAGGCCAAGAGCTACGGCTTCGTGGACACGGTGCACGGCGCTGACGGCGAGAGCAGTGTGTGGACGACGAATCGC
TTTTGCAACCAATACGCCGCTATGCCGTCGCTACACTTTGGATACTCGCTGCTTATTGGCCTGACGGTTGCCACG
CTGCCCATTTCCGGCCTGCGCCCCATGTCGTGGAAGCGCATGGCCATTGTCGCTGTCGGCATGGCCTATCCGGCC
CTCATTCTGACTGCCATTGTGGCCACGGCAAATCACTTCATCCTCGACGCTGTTGCGGGCGCCGTCGTGTGCGGA
GTGGCCTGGCACGCCAACCAGGTGCTGCTCAACCTGTGCATTGTCGAGGACTATTTCCTCTGGCTGCTGCGCATG
CACAAGCCCGTCAACTACACCGACCCAGACACAGCCGTTGAGCCTGAGCTGCCTGCCACGCTGCTCATGAGCGAA
GAGGTATAG
Transcript >OphauB2|1666
ATGGCTGTGGGTGCCTTTCTCGAGCCACTGGTTGTGGTGACGCTTCTCTTTGGCGGAGCTTGGGTCAACCGCAAC
AAGGAGTACAAGTTTTGGGGCGGCAAACAGTCAGCAGGCTGGACTGGCGAAGCTAGAATAAAGCGCAGCGACGAC
TTGATGGGCCTCGACGCCAGACGCGAATCCGAGGACAGCCTTCTCTCGAGAGACGACTGGAGCGGCAGCTCGACG
CCGACGCTGGCGCCCAACGACGTGTCGACGACGCGCCGCCGCAAGCTGCGATTTTTTGGCTACCAGCGCCTTGTC
TCGACACCAAATACCCTTGTCTTCAAGGACCGATTTCTGAGCCGCGTCCTGCAAAAGTTTCCCTTTCTTGCCGAA
GCCTGGTACTGGGCCCTGATTTACTGGGTTTACCAGCTGGGCCGTGCCTTTACCGCCCTGTCGCTGGTGGAGGGA
ACGGTGCACGTGGCGCGCAAACACGCGCTGCAGCTCATCCATCTCGAGCAGCGGCTGGGCATCTTTTGGGAGGTG
CCGATTCAGCAATGGTTCATTGCGCGCCCCCTGCTGATGCACTGGACCAACCGCGTCTACTCGTTTATCCATATT
CCCGGCACCATCTTCTTCCTCGTCTTCCTCTACTACTTGACGACGACACGCAAGCGGTCAATGGGCAATGCGGGC
ACCAAGGTGGCGGCGGGGCCGGCTCTATACGAGGCGCGGCGTCGCACCATGGCCATGTGCAACCTGCTGGCCTTT
GTCGTCTTCACGCTGTGGCCCTGCATGCCGCCGCGGCTGCTGAGCGATGCCGAGTACACGGGCGACAATGCGGCA
GAGGCCAAGAGCTACGGCTTCGTGGACACGGTGCACGGCGCTGACGGCGAGAGCAGTGTGTGGACGACGAATCGC
TTTTGCAACCAATACGCCGCTATGCCGTCGCTACACTTTGGATACTCGCTGCTTATTGGCCTGACGGTTGCCACG
CTGCCCATTTCCGGCCTGCGCCCCATGTCGTGGAAGCGCATGGCCATTGTCGCTGTCGGCATGGCCTATCCGGCC
CTCATTCTGACTGCCATTGTGGCCACGGCAAATCACTTCATCCTCGACGCTGTTGCGGGCGCCGTCGTGTGCGGA
GTGGCCTGGCACGCCAACCAGGTGCTGCTCAACCTGTGCATTGTCGAGGACTATTTCCTCTGGCTGCTGCGCATG
CACAAGCCCGTCAACTACACCGACCCAGACACAGCCGTTGAGCCTGAGCTGCCTGCCACGCTGCTCATGAGCGAA
GAGGTATAG
Gene >OphauB2|1666
ATGGCTGTGGGTGCCTTTCTCGAGCCACTGGTTGTGGTGACGCTTCTCTTTGGCGGAGCTTGGGTCAACCGCAAC
AAGGAGTACAAGTTTTGGGGCGGCAAACAGTCAGCAGGCTGGACTGGCGAAGCTAGAATAAAGCGCAGCGACGAC
TTGATGGGCCTCGACGCCAGACGCGAATCCGAGGACAGCCTTCTCTCGAGAGACGACTGGAGCGGCAGCTCGACG
CCGACGCTGGCGCCCAACGACGTGTCGACGACGCGCCGCCGCAAGCTGCGATTTTTTGGCTACCAGCGCCTTGTC
TCGACACCAAATACCCTTGTCTTCAAGGACCGATTTCTGAGCCGCGTCCTGCAAAAGTTTCCCTTTCTTGCCGAA
GCCTGGTACTGGGCCCTGATTTACTGGGTAGGTTGTCTTGTGTGTCTTGTGCAATGGCTTGCGTGGCCTGGGCGG
GAGCTGACATTGAATGGCTTGCGTCAGGTTTACCAGCTGGGCCGTGCCTTTACCGCCCTGTCGCTGGTGGAGGGA
ACGGTGCACGTGGCGCGCAAACACGCGCTGCAGCTCATCCATCTCGAGCAGCGGCTGGGCATCTTTTGGGAGGTG
CCGATTCAGCAATGGTTCATTGCGCGCCCCCTGCTGATGCACTGGACCAACCGCGTCTACTCGTTTATCCATATT
CCCGGCACCATCTTCTTCCTCGTCTTCCTCTACTACTTGACGACGACACGCAAGCGGTCAATGGGCAATGCGGGC
ACCAAGGTGGCGGCGGGGCCGGCTCTATACGAGGCGCGGCGTCGCACCATGGCCATGTGCAACCTGCTGGCCTTT
GTCGTCTTCACGCTGTGGCCCTGCATGCCGCCGCGGCTGCTGAGCGATGCCGAGTACACGGGCGACAATGCGGCA
GAGGCCAAGAGCTACGGCTTCGTGGACACGGTGCACGGCGCTGACGGCGAGAGCAGTGTGTGGACGACGAATCGC
TTTTGCAACCAATACGGTGCGTAACTAGCTGACGCGTTTGCTTGCGGAATTGACTGACGTGTGCACAGCCGCTAT
GCCGTCGCTACACTTTGGATACTCGCTGCTTATTGGCCTGACGGTTGCCACGCTGCCCATTTCCGGCCTGCGCCC
CATGTCGTGGAAGCGCATGGCCATTGTCGCTGTCGGCATGGCCTATCCGGCCCTCATTCTGACTGCCATTGTGGC
CACGGCAAATCACTTCATCCTCGACGCTGTTGCGGGCGCCGTCGTGTGCGGAGTGGCCTGGCACGCCAACCAGGT
GCTGCTCAACCTGTGCATTGTCGAGGACTATTTCCTCTGGCTGCTGCGCATGCACAAGCCCGTCAACTACACCGA
CCCAGACACAGCCGTTGAGCCTGAGCTGCCTGCCACGCTGCTCATGAGCGAAGAGGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail