Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1665
Gene name
LocationContig_147:1395..3966
Strand-
Gene length (bp)2571
Transcript length (bp)2358
Coding sequence length (bp)2358
Protein length (aa) 786

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.6E-36 422 666
PF12068 PH_RBD Rab-binding domain (RBD) 3.4E-06 43 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 41 714 0.0E+00
sp|P09379|GYP7_YARLI GTPase-activating protein GYP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GYP7 PE=3 SV=2 31 770 0.0E+00
sp|Q6BU76|GYP7_DEBHA GTPase-activating protein GYP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GYP7 PE=3 SV=2 41 752 0.0E+00
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 40 769 6.0E-159
sp|P48365|GYP7_YEAST GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP7 PE=1 SV=1 42 712 3.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 41 714 0.0E+00
sp|P09379|GYP7_YARLI GTPase-activating protein GYP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GYP7 PE=3 SV=2 31 770 0.0E+00
sp|Q6BU76|GYP7_DEBHA GTPase-activating protein GYP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GYP7 PE=3 SV=2 41 752 0.0E+00
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 40 769 6.0E-159
sp|P48365|GYP7_YEAST GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP7 PE=1 SV=1 42 712 3.0E-144
sp|Q9CXF4|TBC15_MOUSE TBC1 domain family member 15 OS=Mus musculus GN=Tbc1d15 PE=1 SV=1 379 699 4.0E-70
sp|Q8TC07|TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens GN=TBC1D15 PE=1 SV=2 379 699 4.0E-69
sp|Q8BYH7|TBC17_MOUSE TBC1 domain family member 17 OS=Mus musculus GN=Tbc1d17 PE=1 SV=2 379 703 2.0E-63
sp|Q9HA65|TBC17_HUMAN TBC1 domain family member 17 OS=Homo sapiens GN=TBC1D17 PE=1 SV=2 379 703 9.0E-60
sp|Q8TBP0|TBC16_HUMAN TBC1 domain family member 16 OS=Homo sapiens GN=TBC1D16 PE=2 SV=1 406 704 7.0E-37
sp|Q2NKQ1|SGSM1_HUMAN Small G protein signaling modulator 1 OS=Homo sapiens GN=SGSM1 PE=1 SV=2 484 708 3.0E-32
sp|Q8BPQ7|SGSM1_MOUSE Small G protein signaling modulator 1 OS=Mus musculus GN=Sgsm1 PE=1 SV=2 484 708 8.0E-32
sp|A1A5B6|TBC25_MOUSE TBC1 domain family member 25 OS=Mus musculus GN=Tbc1d25 PE=1 SV=1 383 643 4.0E-31
sp|Q3MII6|TBC25_HUMAN TBC1 domain family member 25 OS=Homo sapiens GN=TBC1D25 PE=1 SV=2 383 643 4.0E-31
sp|O43147|SGSM2_HUMAN Small G protein signaling modulator 2 OS=Homo sapiens GN=SGSM2 PE=1 SV=4 484 708 8.0E-31
sp|Q80U12|SGSM2_MOUSE Small G protein signaling modulator 2 OS=Mus musculus GN=Sgsm2 PE=1 SV=2 484 708 1.0E-30
sp|Q8IYX1|TBC21_HUMAN TBC1 domain family member 21 OS=Homo sapiens GN=TBC1D21 PE=2 SV=1 374 691 5.0E-25
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 538 759 3.0E-11
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 517 668 5.0E-11
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 517 668 9.0E-11
sp|O59737|GYP1_SCHPO GTPase-activating protein gyp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp1 PE=3 SV=1 423 661 2.0E-10
sp|Q95LL3|TB22B_MACFA TBC1 domain family member 22B OS=Macaca fascicularis GN=TBC1D22B PE=2 SV=1 422 667 8.0E-10
sp|Q9NU19|TB22B_HUMAN TBC1 domain family member 22B OS=Homo sapiens GN=TBC1D22B PE=1 SV=3 422 667 1.0E-09
sp|Q8BM85|TBCK_MOUSE TBC domain-containing protein kinase-like protein OS=Mus musculus GN=Tbck PE=1 SV=1 536 700 1.0E-09
sp|Q8TEA7|TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens GN=TBCK PE=1 SV=4 536 700 1.0E-09
sp|Q8CGA2|TBC14_MOUSE TBC1 domain family member 14 OS=Mus musculus GN=Tbc1d14 PE=1 SV=2 485 666 1.0E-08
sp|Q9P2M4|TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens GN=TBC1D14 PE=1 SV=3 485 673 1.0E-08
sp|Q5CD77|TBC14_RAT TBC1 domain family member 14 OS=Rattus norvegicus GN=Tbc1d14 PE=2 SV=2 485 666 1.0E-08
sp|Q8R5A6|TB22A_MOUSE TBC1 domain family member 22A OS=Mus musculus GN=Tbc1d22a PE=1 SV=3 540 703 2.0E-08
sp|Q8WUA7|TB22A_HUMAN TBC1 domain family member 22A OS=Homo sapiens GN=TBC1D22A PE=1 SV=2 540 703 4.0E-08
sp|Q95KI1|TB22A_MACFA TBC1 domain family member 22A (Fragment) OS=Macaca fascicularis GN=TBC1D22A PE=2 SV=2 540 703 6.0E-08
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 523 682 8.0E-08
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 493 663 8.0E-08
sp|Q9URY3|YLOH_SCHPO TBC domain-containing protein C1952.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.17c PE=3 SV=4 520 648 1.0E-07
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 522 680 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1665
MASGSSARAGDASPSESYYALSDDEEGDYNTITHTETGRGVKLLFSKSKVYVHPTPSSKDNIAGYIALLQQKSGR
ESPPTSPASSDLLLAWIPESALGDSASIYVKVDLCDGDSPPRQSYLVPPPPTVTTHSGSVGGYSFAIPVSAIYSL
LVRPPSLGWWYGSVVINSRAGDSFPALFFHDNECQSTMLQKKKLTRDSFDPFGESGQMFWGADEVLRWLRRYVKI
ERSGAEPNIYLVEPSSEDLEAFGGKPTVASRSGQGRDAEMDPFVKLIKETGWSLMNQFSKVTTFTRRAAQDFADN
SNMPPQVKRLLRNPEVQTLQDEFDSARIYLARWAMGIAEQSERDRRGRIWTVRDVAELEDTDVGEFELLEGTNSL
SLDERRRPVSMKEWKSFFDGETGRLSVTMDEVKERVFHGGLDPDDGVRKEAWLFLLGVYEWYSTEEERRAQMASL
RDQYYRLKQSWWERLENEGGEGERGEWWREQRGRIEKDVHRTDRNVAIFQGEDTPHPDPNSPFADVGTNMHLEQM
KEMLLTYNEHNKDLGYVQGMSDLLAPIYAVVQDDAVAFWAFEHFMERMERNFLRDQSGMRAQLLALDQLVNFMDP
KLWNHLQAADSTNFFFLFRMILVWYKREFAWEHVLRLWETLWTDYLSANFHLFIALAILEKHRDVMMQHLKAFDE
VLKYVNELSNTIDLESTLVRAESLFRRFQRQVEAIDKKQNFPAPRPSHAGNSSSSSDAQTRPAGTKKKAAEQQEQ
EQKTITPELRRLLSRKVEVLPRPTVAQKGNGMPAK*
Coding >OphauB2|1665
ATGGCTTCCGGCTCCAGCGCTCGGGCTGGCGATGCGTCGCCCTCGGAGAGTTACTACGCCCTGAGCGACGACGAA
GAAGGCGACTACAATACCATTACCCATACCGAGACGGGACGGGGCGTCAAGCTGCTCTTTTCCAAGAGCAAGGTC
TATGTCCATCCCACGCCCTCGTCCAAGGACAATATTGCTGGCTATATTGCCCTGCTGCAACAAAAGTCGGGGCGC
GAGTCTCCGCCGACAAGTCCTGCCTCGTCTGACCTTTTGCTGGCCTGGATCCCAGAGTCGGCTCTGGGCGACTCG
GCTAGCATCTACGTCAAGGTTGATCTCTGCGATGGCGATTCGCCGCCACGCCAGTCGTATCTAGTTCCTCCGCCG
CCTACAGTCACGACGCACAGCGGCTCGGTGGGCGGCTACTCGTTTGCGATTCCTGTCAGCGCCATATACTCGCTT
CTGGTACGCCCGCCCAGCCTAGGCTGGTGGTATGGCTCCGTTGTCATCAACTCGCGCGCTGGAGATAGTTTTCCC
GCCCTCTTCTTCCACGACAATGAGTGCCAGAGCACCATGTTGCAAAAGAAGAAGCTGACGCGCGACTCGTTTGAC
CCCTTTGGCGAGAGCGGGCAAATGTTTTGGGGGGCCGACGAAGTATTACGCTGGCTGCGGCGCTACGTCAAGATT
GAACGATCGGGAGCCGAGCCGAATATTTATCTCGTGGAGCCGAGCAGCGAAGACTTGGAGGCGTTTGGGGGCAAG
CCAACGGTGGCGTCTCGGTCGGGCCAAGGCCGAGATGCTGAGATGGATCCCTTTGTCAAGCTCATCAAGGAGACG
GGCTGGAGCCTGATGAACCAGTTTAGCAAGGTGACGACGTTTACCCGCCGTGCAGCCCAAGACTTTGCCGACAAC
TCGAATATGCCGCCGCAGGTGAAGCGGCTGCTGCGCAACCCCGAGGTGCAGACGCTGCAGGATGAGTTTGACAGT
GCGCGCATCTATCTCGCGCGGTGGGCCATGGGCATCGCCGAGCAGAGCGAACGCGACCGACGTGGCCGCATCTGG
ACTGTGCGAGACGTTGCCGAGCTCGAGGACACGGATGTGGGCGAGTTTGAGCTCCTCGAGGGCACCAACTCGCTG
TCACTTGACGAGAGGCGGCGGCCAGTCAGCATGAAGGAGTGGAAGTCGTTTTTTGATGGCGAGACTGGGCGTCTG
TCAGTCACCATGGACGAGGTCAAGGAGCGCGTCTTCCACGGCGGGCTGGACCCTGACGACGGGGTGCGCAAAGAG
GCCTGGCTCTTCCTGCTCGGTGTCTACGAATGGTATAGCACCGAGGAGGAGCGGAGGGCGCAGATGGCGTCGTTG
CGCGACCAGTACTACCGCCTCAAGCAGTCGTGGTGGGAGCGGCTGGAGAATGAAGGGGGCGAGGGCGAGAGGGGC
GAATGGTGGCGGGAGCAGAGGGGACGCATTGAAAAGGACGTGCACCGGACGGACCGCAACGTGGCCATTTTCCAG
GGCGAAGACACGCCGCATCCCGACCCCAACTCTCCCTTTGCCGACGTGGGCACCAACATGCACCTGGAGCAGATG
AAGGAGATGCTGCTGACGTACAATGAGCACAACAAGGACCTGGGCTACGTGCAGGGCATGTCGGACCTGCTGGCG
CCCATTTACGCCGTTGTCCAGGACGACGCGGTAGCCTTTTGGGCCTTTGAGCACTTTATGGAGCGCATGGAGCGC
AATTTCCTGCGCGACCAGTCGGGCATGCGGGCGCAGCTGCTGGCGCTCGACCAGCTCGTCAACTTTATGGACCCC
AAGCTGTGGAACCACTTGCAGGCGGCCGACAGCACCAACTTTTTCTTCTTGTTCCGCATGATTCTTGTCTGGTAT
AAGCGCGAGTTTGCCTGGGAGCATGTGCTGCGCCTGTGGGAGACGCTGTGGACGGATTACTTGAGTGCAAATTTT
CACTTGTTTATTGCGCTGGCCATTTTGGAGAAGCATCGCGATGTCATGATGCAGCACCTCAAGGCCTTTGACGAG
GTGCTCAAATATGTCAATGAGCTCTCCAACACAATTGACCTCGAATCAACGCTGGTGCGTGCCGAATCCTTGTTT
CGGCGTTTTCAGCGCCAGGTCGAGGCCATTGACAAGAAGCAAAATTTCCCCGCGCCCCGACCCTCCCACGCCGGC
AACAGCAGCAGCAGCAGTGATGCCCAGACACGGCCAGCGGGAACCAAGAAGAAGGCAGCAGAGCAACAGGAGCAA
GAGCAAAAGACGATTACGCCCGAGCTGCGCAGGCTGTTGAGCAGAAAGGTCGAGGTACTGCCGCGGCCTACCGTG
GCTCAAAAAGGAAATGGCATGCCGGCAAAGTGA
Transcript >OphauB2|1665
ATGGCTTCCGGCTCCAGCGCTCGGGCTGGCGATGCGTCGCCCTCGGAGAGTTACTACGCCCTGAGCGACGACGAA
GAAGGCGACTACAATACCATTACCCATACCGAGACGGGACGGGGCGTCAAGCTGCTCTTTTCCAAGAGCAAGGTC
TATGTCCATCCCACGCCCTCGTCCAAGGACAATATTGCTGGCTATATTGCCCTGCTGCAACAAAAGTCGGGGCGC
GAGTCTCCGCCGACAAGTCCTGCCTCGTCTGACCTTTTGCTGGCCTGGATCCCAGAGTCGGCTCTGGGCGACTCG
GCTAGCATCTACGTCAAGGTTGATCTCTGCGATGGCGATTCGCCGCCACGCCAGTCGTATCTAGTTCCTCCGCCG
CCTACAGTCACGACGCACAGCGGCTCGGTGGGCGGCTACTCGTTTGCGATTCCTGTCAGCGCCATATACTCGCTT
CTGGTACGCCCGCCCAGCCTAGGCTGGTGGTATGGCTCCGTTGTCATCAACTCGCGCGCTGGAGATAGTTTTCCC
GCCCTCTTCTTCCACGACAATGAGTGCCAGAGCACCATGTTGCAAAAGAAGAAGCTGACGCGCGACTCGTTTGAC
CCCTTTGGCGAGAGCGGGCAAATGTTTTGGGGGGCCGACGAAGTATTACGCTGGCTGCGGCGCTACGTCAAGATT
GAACGATCGGGAGCCGAGCCGAATATTTATCTCGTGGAGCCGAGCAGCGAAGACTTGGAGGCGTTTGGGGGCAAG
CCAACGGTGGCGTCTCGGTCGGGCCAAGGCCGAGATGCTGAGATGGATCCCTTTGTCAAGCTCATCAAGGAGACG
GGCTGGAGCCTGATGAACCAGTTTAGCAAGGTGACGACGTTTACCCGCCGTGCAGCCCAAGACTTTGCCGACAAC
TCGAATATGCCGCCGCAGGTGAAGCGGCTGCTGCGCAACCCCGAGGTGCAGACGCTGCAGGATGAGTTTGACAGT
GCGCGCATCTATCTCGCGCGGTGGGCCATGGGCATCGCCGAGCAGAGCGAACGCGACCGACGTGGCCGCATCTGG
ACTGTGCGAGACGTTGCCGAGCTCGAGGACACGGATGTGGGCGAGTTTGAGCTCCTCGAGGGCACCAACTCGCTG
TCACTTGACGAGAGGCGGCGGCCAGTCAGCATGAAGGAGTGGAAGTCGTTTTTTGATGGCGAGACTGGGCGTCTG
TCAGTCACCATGGACGAGGTCAAGGAGCGCGTCTTCCACGGCGGGCTGGACCCTGACGACGGGGTGCGCAAAGAG
GCCTGGCTCTTCCTGCTCGGTGTCTACGAATGGTATAGCACCGAGGAGGAGCGGAGGGCGCAGATGGCGTCGTTG
CGCGACCAGTACTACCGCCTCAAGCAGTCGTGGTGGGAGCGGCTGGAGAATGAAGGGGGCGAGGGCGAGAGGGGC
GAATGGTGGCGGGAGCAGAGGGGACGCATTGAAAAGGACGTGCACCGGACGGACCGCAACGTGGCCATTTTCCAG
GGCGAAGACACGCCGCATCCCGACCCCAACTCTCCCTTTGCCGACGTGGGCACCAACATGCACCTGGAGCAGATG
AAGGAGATGCTGCTGACGTACAATGAGCACAACAAGGACCTGGGCTACGTGCAGGGCATGTCGGACCTGCTGGCG
CCCATTTACGCCGTTGTCCAGGACGACGCGGTAGCCTTTTGGGCCTTTGAGCACTTTATGGAGCGCATGGAGCGC
AATTTCCTGCGCGACCAGTCGGGCATGCGGGCGCAGCTGCTGGCGCTCGACCAGCTCGTCAACTTTATGGACCCC
AAGCTGTGGAACCACTTGCAGGCGGCCGACAGCACCAACTTTTTCTTCTTGTTCCGCATGATTCTTGTCTGGTAT
AAGCGCGAGTTTGCCTGGGAGCATGTGCTGCGCCTGTGGGAGACGCTGTGGACGGATTACTTGAGTGCAAATTTT
CACTTGTTTATTGCGCTGGCCATTTTGGAGAAGCATCGCGATGTCATGATGCAGCACCTCAAGGCCTTTGACGAG
GTGCTCAAATATGTCAATGAGCTCTCCAACACAATTGACCTCGAATCAACGCTGGTGCGTGCCGAATCCTTGTTT
CGGCGTTTTCAGCGCCAGGTCGAGGCCATTGACAAGAAGCAAAATTTCCCCGCGCCCCGACCCTCCCACGCCGGC
AACAGCAGCAGCAGCAGTGATGCCCAGACACGGCCAGCGGGAACCAAGAAGAAGGCAGCAGAGCAACAGGAGCAA
GAGCAAAAGACGATTACGCCCGAGCTGCGCAGGCTGTTGAGCAGAAAGGTCGAGGTACTGCCGCGGCCTACCGTG
GCTCAAAAAGGAAATGGCATGCCGGCAAAGTGA
Gene >OphauB2|1665
ATGGCTTCCGGCTCCAGCGCTCGGGCTGGCGATGCGTCGCCCTCGGAGAGTTACTACGCCCTGAGCGACGACGAA
GAAGGCGACTACAATACCATTACCCATACCGAGACGGGACGGGGCGTCAAGCTGCTCTTTTCCAAGAGCAAGGTG
TGTCTTTTTTTTCCTCTCTGGCAGTCTGGTGGCCTGCCCCGGTTTTTGCAAAAACCTAATACGTCATGCGCCACC
AGGTCTATGTCCATCCCACGCCCTCGTCCAAGGACAATATTGCTGGCTATATTGCCCTGCTGCAACAAAAGTCGG
GGCGCGAGTCTCCGCCGACAAGTCCTGCCTCGTCTGACCTTTTGCTGGCCTGGATCCCAGAGTCGGCTCTGGGCG
ACTCGGCTAGCATCTACGTCAAGGTTGATCTCTGCGATGGCGATTCGCCGCCACGCCAGTCGTATCTAGTTCCTC
CGCCGCCTACAGTCACGACGCACAGCGGCTCGGTGGGCGGCTACTCGTTTGCGATTCCTGTCAGCGCCATATACT
CGCTTCTGGTACGCCCGCCCAGCCTAGGCTGGTGGTATGGCTCCGTTGTCATCAACTCGCGCGCTGGAGATAGTT
TTCCCGCCCTCTTCTTCCACGACAATGAGTGCCAGAGCACCATGTTGCAAAAGAAGAAGCTGACGCGCGACTCGT
TTGACCCCTTTGGCGAGAGCGGGCAAATGTTTTGGGGGGCCGACGAAGTATTACGCTGGCTGCGGCGCTACGTCA
AGATTGAACGATCGGGAGCCGAGCCGAATATTTATCTCGTGGAGCCGAGCAGCGAAGACTTGGAGGCGTTTGGGG
GCAAGCCAACGGTGGCGTCTCGGTCGGGCCAAGGCCGAGATGCTGAGATGGATCCCTTTGTCAAGCTCATCAAGG
AGACGGGCTGGAGCCTGATGAACCAGTTTAGCAAGGTGACGACGTTTACCCGCCGTGCAGCCCAAGACTTTGCCG
ACAACTCGAATATGCCGCCGCAGGTGAAGCGGCTGCTGCGCAACCCCGAGGTGCAGACGCTGCAGGATGAGTTTG
ACAGTGCGCGCATCTATCTCGCGCGGTGGGCCATGGGCATCGCCGAGCAGAGCGAACGCGACCGACGTGGCCGCA
TCTGGACTGTGCGAGACGTTGCCGAGCTCGAGGACACGGATGTGGGCGAGTTTGAGCTCCTCGAGGGCACCAACT
CGCTGTCACTTGACGAGAGGCGGCGGCCAGTCAGCATGAAGGAGTGGAAGTCGTTTTTTGATGGCGAGACTGGGC
GTCTGTCAGTCACCATGGACGAGGTCAAGGAGCGCGTCTTCCACGGCGGGCTGGACCCTGACGACGGGGTGCGCA
AAGAGGCCTGGCTCTTCCTGCTCGGTGTCTACGAATGGTATAGCACCGAGGAGGAGCGGAGGGCGCAGATGGCGT
CGTTGCGCGACCAGTACTACCGCCTCAAGCAGTCGTGGTGGGAGCGGCTGGAGAATGAAGGGGGCGAGGGCGAGA
GGGGCGAATGGTGGCGGGAGCAGAGGGGACGCATTGGTGAGTCTTGAGCTGCTCCTTGTGCGGCGCCTAGAGGCT
GACTGGCTGCCGCCGTGATAGAAAAGGACGTGCACCGGACGGACCGCAACGTGGCCATTTTCCAGGGCGAAGACA
CGCCGCATCCCGACCCCAACTCTCCCTTTGCCGACGTGGGCACCAACATGCACCTGGAGCAGATGAAGGAGATGC
TGCTGACGTACAATGAGCACAACAAGGACCTGGGCTACGTGCAGGGCATGTCGGACCTGCTGGCGCCCATTTACG
CCGTTGTCCAGGACGACGCGGTAGCCTTTTGGGCCTTTGAGCACTTTATGGAGCGCATGGAGCGCAATTTCCTGC
GCGACCAGTCGGGCATGCGGGCGCAGCTGCTGGCGCTCGACCAGCTCGTCAACTTTATGGACCCCAAGCTGTGGA
ACCACTTGCAGGCGGCCGACAGCACCAACTTTTTCTTCTTGTTCCGCATGATTCTTGTCTGGTATAAGCGCGAGT
TTGCCTGGGAGCATGTGCTGCGCCTGTGGGAGACGCTGTGGACGGATTACTTGAGTGCAAATTTTCACTTGTTTA
TTGCGCTGGCCATTTTGGAGAAGCATCGCGATGTCATGATGCAGCACCTCAAGGCCTTTGACGAGGTGCTCAAAT
ATGGTTCGTTTTTGACTCTTTCTCTCTCTCTATCTACTTTTGCCCGCCCCCCCCCGGCTAACTAGATATCCGGCA
GTCAATGAGCTCTCCAACACAATTGACCTCGAATCAACGCTGGTGCGTGCCGAATCCTTGTTTCGGCGTTTTCAG
CGCCAGGTCGAGGCCATTGACAAGAAGCAAAATTTCCCCGCGCCCCGACCCTCCCACGCCGGCAACAGCAGCAGC
AGCAGTGATGCCCAGACACGGCCAGCGGGAACCAAGAAGAAGGCAGCAGAGCAACAGGAGCAAGAGCAAAAGACG
ATTACGCCCGAGCTGCGCAGGCTGTTGAGCAGAAAGGTCGAGGTACTGCCGCGGCCTACCGTGGCTCAAAAAGGA
AATGGCATGCCGGCAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail