Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1654
Gene name
LocationContig_146:21245..22640
Strand+
Gene length (bp)1395
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03798 TRAM_LAG1_CLN8 TLC domain 9.9E-37 184 389
PF08390 TRAM1 TRAM1-like protein 1.1E-22 124 180

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZSP9|LAG1_YEAS7 Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAG1 PE=3 SV=1 21 418 4.0E-105
sp|P38703|LAG1_YEAST Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAG1 PE=1 SV=1 21 418 7.0E-105
sp|O59735|LAC1_SCHPO Sphingosine N-acyltransferase lac1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lac1 PE=1 SV=2 61 393 7.0E-103
sp|P28496|LAC1_YEAST Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAC1 PE=1 SV=2 21 401 5.0E-91
sp|A6ZZV7|LAC1_YEAS7 Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAC1 PE=3 SV=1 21 401 5.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZSP9|LAG1_YEAS7 Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAG1 PE=3 SV=1 21 418 4.0E-105
sp|P38703|LAG1_YEAST Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAG1 PE=1 SV=1 21 418 7.0E-105
sp|O59735|LAC1_SCHPO Sphingosine N-acyltransferase lac1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lac1 PE=1 SV=2 61 393 7.0E-103
sp|P28496|LAC1_YEAST Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAC1 PE=1 SV=2 21 401 5.0E-91
sp|A6ZZV7|LAC1_YEAS7 Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAC1 PE=3 SV=1 21 401 5.0E-91
sp|P78970|LAG1_SCHPO Sphingosine N-acyltransferase lag1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lag1 PE=1 SV=2 104 420 6.0E-44
sp|Q9D6J1|CERS4_MOUSE Ceramide synthase 4 OS=Mus musculus GN=Cers4 PE=1 SV=1 173 415 6.0E-18
sp|Q5E9R6|CERS4_BOVIN Ceramide synthase 4 OS=Bos taurus GN=CERS4 PE=2 SV=1 173 431 6.0E-17
sp|Q924Z4|CERS2_MOUSE Ceramide synthase 2 OS=Mus musculus GN=Cers2 PE=1 SV=1 184 406 5.0E-16
sp|Q96G23|CERS2_HUMAN Ceramide synthase 2 OS=Homo sapiens GN=CERS2 PE=1 SV=1 184 406 6.0E-16
sp|Q3ZBF8|CERS2_BOVIN Ceramide synthase 2 OS=Bos taurus GN=CERS2 PE=2 SV=1 184 406 6.0E-16
sp|G5ED45|HYL1_CAEEL Ceramide synthase hyl-1 OS=Caenorhabditis elegans GN=hyl-1 PE=1 SV=1 176 433 8.0E-16
sp|Q6NQI8|LAG13_ARATH LAG1 longevity assurance homolog 3 OS=Arabidopsis thaliana GN=At1g13580 PE=2 SV=2 179 411 2.0E-15
sp|Q84QC0|ASCL3_ORYSJ ASC1-like protein 3 OS=Oryza sativa subsp. japonica GN=Os03g0264000 PE=2 SV=1 179 411 7.0E-15
sp|Q6ZMG9|CERS6_HUMAN Ceramide synthase 6 OS=Homo sapiens GN=CERS6 PE=1 SV=1 173 404 2.0E-14
sp|Q9LJK3|LAG12_ARATH LAG1 longevity assurance homolog 2 OS=Arabidopsis thaliana GN=LAG2 PE=1 SV=1 170 411 2.0E-14
sp|Q6EUN0|ASCL1_ORYSJ ASC1-like protein 1 OS=Oryza sativa subsp. japonica GN=Os02g0581300 PE=2 SV=1 178 411 2.0E-14
sp|Q6YWS8|ASCL2_ORYSJ ASC1-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0728300 PE=3 SV=2 158 390 5.0E-14
sp|Q9LDF2|LAG11_ARATH LAG1 longevity assurance homolog 1 OS=Arabidopsis thaliana GN=LAG1 PE=2 SV=1 181 411 3.0E-13
sp|Q8C172|CERS6_MOUSE Ceramide synthase 6 OS=Mus musculus GN=Cers6 PE=1 SV=1 173 395 4.0E-13
sp|Q8W4Y5|ASCL_SOLLC ASC1-like protein OS=Solanum lycopersicum PE=2 SV=1 148 418 4.0E-12
sp|Q9D6K9|CERS5_MOUSE Ceramide synthase 5 OS=Mus musculus GN=Cers5 PE=1 SV=1 184 404 1.0E-11
sp|Q9HA82|CERS4_HUMAN Ceramide synthase 4 OS=Homo sapiens GN=CERS4 PE=1 SV=2 163 412 1.0E-11
sp|Q8N5B7|CERS5_HUMAN Ceramide synthase 5 OS=Homo sapiens GN=CERS5 PE=2 SV=1 184 404 3.0E-11
sp|Q7Z139|HYL2_CAEEL Ceramide synthase hyl-2 OS=Caenorhabditis elegans GN=hyl-2 PE=1 SV=1 170 309 2.0E-09
sp|Q9M6A3|ASC1_SOLLC Protein ASC1 OS=Solanum lycopersicum GN=Asc-1 PE=2 SV=2 179 411 7.0E-08
sp|Q8IU89|CERS3_HUMAN Ceramide synthase 3 OS=Homo sapiens GN=CERS3 PE=1 SV=2 172 405 3.0E-07
sp|P27544|CERS1_HUMAN Ceramide synthase 1 OS=Homo sapiens GN=CERS1 PE=1 SV=1 160 310 8.0E-07
sp|P27545|CERS1_MOUSE Ceramide synthase 1 OS=Mus musculus GN=Cers1 PE=1 SV=1 167 340 1.0E-06
sp|Q924Z5|TRAM2_MOUSE Translocating chain-associated membrane protein 2 OS=Mus musculus GN=Tram2 PE=1 SV=1 105 243 1.0E-06
sp|Q1A3B0|CERS3_MOUSE Ceramide synthase 3 OS=Mus musculus GN=Cers3 PE=1 SV=1 180 407 3.0E-06
sp|Q15035|TRAM2_HUMAN Translocating chain-associated membrane protein 2 OS=Homo sapiens GN=TRAM2 PE=1 SV=1 105 243 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 100 122 22
2 142 164 22
3 189 211 22
4 231 253 22
5 269 291 22
6 306 328 22
7 363 385 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1654
MAEPFPLLNTSADQLHGDGGVAARRRRKSSGLGSDICVGDTGAPALASSSTSLKLNGSTDSSTNTSFSSTPALKP
QRLSKRRRARGVVSRMRQTMMKHTFVLPACILALVLSGYALNPLPANPLHRFIFLSYRLDNGHYAKGPWDVAFVA
FYTLVLSFTREFVMQELLRPLARRTGLARAKQARFMEQAYTAIYFGLLGPAGLYVMSRTPVWYFSTRGMYEHFPH
RDHEAVVKFYYLFQAAYWAQQAIVLILGMEKPRKDFKELVGHHIVSLALIALSYRFHFTYIGIAVYTTHDISDFF
LATSKILNYIDHPLVGPYFFLFIAVWIYMRHFINLRILWSLFTDFRHVGPFELNWNTEQYKCWISQYITTALLAS
LQALNLFWLFCIIRIAYRLVWLNVAEDDRSEDDDDDAEPTHHNHNHHRKLAERHTATSLKPLPAKSQDLHPVLPS
LELNGEALGTPHAQ*
Coding >OphauB2|1654
ATGGCGGAGCCGTTTCCGCTGCTCAACACATCGGCGGACCAGCTCCATGGCGACGGGGGCGTGGCGGCGCGGCGA
CGGCGCAAGAGCAGCGGTCTGGGCAGCGACATATGCGTGGGCGACACGGGCGCCCCTGCGCTGGCCTCGAGCAGC
ACCAGCCTCAAGCTCAACGGCAGCACCGACAGTTCCACAAACACCTCGTTTTCCTCGACGCCTGCACTCAAGCCG
CAGCGACTGTCGAAGCGCCGGCGCGCGCGGGGCGTCGTGTCGCGCATGCGCCAGACCATGATGAAGCACACCTTT
GTCCTGCCTGCCTGCATCCTGGCGCTGGTGCTGTCGGGCTATGCGCTGAATCCCTTGCCTGCCAATCCGCTGCAC
CGCTTCATCTTTCTCTCGTACCGCCTCGACAATGGCCACTACGCCAAGGGCCCCTGGGACGTGGCCTTTGTCGCC
TTTTACACCCTCGTCTTGAGCTTCACCCGCGAGTTTGTCATGCAGGAGCTGCTGCGGCCTCTGGCGCGCCGCACT
GGCCTCGCTCGCGCCAAGCAGGCTCGCTTCATGGAGCAGGCCTACACGGCTATTTACTTTGGCCTCCTCGGCCCC
GCCGGCCTCTACGTCATGAGCCGCACCCCCGTTTGGTACTTTAGCACCCGCGGCATGTATGAGCACTTCCCCCAT
CGCGACCACGAGGCCGTGGTCAAGTTTTACTACCTCTTCCAGGCCGCCTACTGGGCCCAGCAGGCCATTGTCCTC
ATCCTCGGCATGGAGAAGCCCCGCAAGGACTTCAAGGAGCTCGTCGGCCACCACATTGTCAGCCTCGCCCTCATT
GCCCTCAGCTACCGCTTCCACTTTACCTATATTGGCATCGCCGTCTACACCACCCACGACATTAGCGACTTTTTC
CTCGCCACCTCCAAGATTCTCAACTACATTGACCATCCCCTCGTCGGCCCTTACTTCTTCCTCTTCATCGCCGTC
TGGATCTACATGCGCCACTTTATCAACCTGCGCATCCTCTGGTCCCTCTTTACCGACTTTCGCCATGTTGGGCCC
TTTGAGCTAAACTGGAATACCGAGCAGTATAAATGCTGGATCAGCCAGTACATCACTACGGCCCTCTTGGCCTCT
CTGCAGGCTCTCAACCTCTTTTGGCTCTTTTGCATCATTCGCATCGCCTATCGCCTCGTCTGGCTCAATGTCGCA
GAGGACGACCGCTCCGAAGACGACGACGACGACGCCGAGCCTACACACCATAACCACAACCACCACCGCAAGCTT
GCCGAGCGCCACACTGCAACAAGCCTCAAGCCCCTGCCCGCCAAATCCCAAGACTTGCACCCCGTCCTGCCCTCG
CTCGAGCTCAATGGCGAGGCCTTGGGCACCCCCCATGCCCAATGA
Transcript >OphauB2|1654
ATGGCGGAGCCGTTTCCGCTGCTCAACACATCGGCGGACCAGCTCCATGGCGACGGGGGCGTGGCGGCGCGGCGA
CGGCGCAAGAGCAGCGGTCTGGGCAGCGACATATGCGTGGGCGACACGGGCGCCCCTGCGCTGGCCTCGAGCAGC
ACCAGCCTCAAGCTCAACGGCAGCACCGACAGTTCCACAAACACCTCGTTTTCCTCGACGCCTGCACTCAAGCCG
CAGCGACTGTCGAAGCGCCGGCGCGCGCGGGGCGTCGTGTCGCGCATGCGCCAGACCATGATGAAGCACACCTTT
GTCCTGCCTGCCTGCATCCTGGCGCTGGTGCTGTCGGGCTATGCGCTGAATCCCTTGCCTGCCAATCCGCTGCAC
CGCTTCATCTTTCTCTCGTACCGCCTCGACAATGGCCACTACGCCAAGGGCCCCTGGGACGTGGCCTTTGTCGCC
TTTTACACCCTCGTCTTGAGCTTCACCCGCGAGTTTGTCATGCAGGAGCTGCTGCGGCCTCTGGCGCGCCGCACT
GGCCTCGCTCGCGCCAAGCAGGCTCGCTTCATGGAGCAGGCCTACACGGCTATTTACTTTGGCCTCCTCGGCCCC
GCCGGCCTCTACGTCATGAGCCGCACCCCCGTTTGGTACTTTAGCACCCGCGGCATGTATGAGCACTTCCCCCAT
CGCGACCACGAGGCCGTGGTCAAGTTTTACTACCTCTTCCAGGCCGCCTACTGGGCCCAGCAGGCCATTGTCCTC
ATCCTCGGCATGGAGAAGCCCCGCAAGGACTTCAAGGAGCTCGTCGGCCACCACATTGTCAGCCTCGCCCTCATT
GCCCTCAGCTACCGCTTCCACTTTACCTATATTGGCATCGCCGTCTACACCACCCACGACATTAGCGACTTTTTC
CTCGCCACCTCCAAGATTCTCAACTACATTGACCATCCCCTCGTCGGCCCTTACTTCTTCCTCTTCATCGCCGTC
TGGATCTACATGCGCCACTTTATCAACCTGCGCATCCTCTGGTCCCTCTTTACCGACTTTCGCCATGTTGGGCCC
TTTGAGCTAAACTGGAATACCGAGCAGTATAAATGCTGGATCAGCCAGTACATCACTACGGCCCTCTTGGCCTCT
CTGCAGGCTCTCAACCTCTTTTGGCTCTTTTGCATCATTCGCATCGCCTATCGCCTCGTCTGGCTCAATGTCGCA
GAGGACGACCGCTCCGAAGACGACGACGACGACGCCGAGCCTACACACCATAACCACAACCACCACCGCAAGCTT
GCCGAGCGCCACACTGCAACAAGCCTCAAGCCCCTGCCCGCCAAATCCCAAGACTTGCACCCCGTCCTGCCCTCG
CTCGAGCTCAATGGCGAGGCCTTGGGCACCCCCCATGCCCAATGA
Gene >OphauB2|1654
ATGGCGGAGCCGTTTCCGCTGCTCAACACATCGGCGGACCAGCTCCATGGCGACGGGGGCGTGGCGGCGCGGCGA
CGGCGCAAGAGCAGCGGTCTGGGCAGCGACATATGCGTGGGCGACACGGGCGCCCCTGCGCTGGCCTCGAGCAGC
ACCAGCCTCAAGCTCAACGGCAGCACCGACAGTTCCACAAACACCTCGTTTTCCTCGACGCCTGCACTCAAGCCG
CAGCGACTGTCGAAGCGCCGGCGCGCGCGGGGCGTCGTGTCGCGCATGCGCCAGACCATGATGAAGCACACCTTT
GTCCTGCCTGCCTGCATCCTGGCGCTGGTGCTGTCGGGCTATGCGCTGAATCCCTTGCCTGCCAATCCGCTGCAC
CGCTTCATCTTTCTCTCGTACCGCCTCGACAATGGCCACTACGCCAAGGGCCCCTGGGACGTGGCCTTTGTCGCC
TTTTACACCCTCGTCTTGAGCTTCACCCGCGAGTTTGTCATGCAGGAGCTGCTGCGGCCTCTGGCGCGCCGCACT
GGCCTCGCTCGCGCCAAGCAGGCTCGCTTCATGGAGCAGGCCTACACGGCTATTTACTTTGGCCTCCTCGGCCCC
GCCGGCCTCTACGTCATGAGCCGCACCCCCGTTTGGTACTTTAGCACCCGCGGCATGTATGAGCACTTCCCCCAT
CGCGACCACGAGGCCGTGGTCAAGTTTTACTACCTCTTCCAGGCCGCCTACTGGGCCCAGCAGGCCATTGTCCTC
ATCCTCGGCATGGAGAAGCCCCGCAAGGACTTCAAGGAGCTCGTCGGCCACCACATTGTCAGCCTCGCCCTCATT
GCCCTCAGCTACCGCTTCCACTTTACCTATATTGGCATCGCCGTCTACACCACCCACGACATTAGCGACTTTTTC
CTCGCCACCTCCAAGATTCTCAACTACATTGACCATCCCCTCGTCGGCCCTTACTTCTTCCTCTTCATCGCCGTC
TGGATCTACATGCGCCACTTTATCAACCTGCGCATCCTCTGGTCCCTCTTTACCGACTTTCGCCATGTTGGGCCC
TTTGAGCTAAACTGGAATACCGAGCAGTATAAATGCTGGATCAGCCAGTACATCACTACGGCCCTCTTGGCCTCT
CTGCAGGCTCTCAACCTCTTTTGGCTCTTTTGCATCATTCGCATCGCCTATCGCCTCGTCTGGCTCAATGTCGCA
GAGGACGACCGCTCCGAAGACGACGACGACGACGCCGAGCCTACACACCATAACCACAACCACCACCGCAAGCTT
GCCGAGCGCCACACTGCAACAAGCCTCAAGCCCCTGCCCGCCAAATCCCAAGACTTGCACCCCGTCCTGCCCTCG
CTCGAGCTCAATGGCGAGGCCTTGGGCACCCCCCATGCCCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail