Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1646
Gene name
LocationContig_145:50406..52809
Strand-
Gene length (bp)2403
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 5.7E-34 427 665
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.2E-10 425 618
PF00550 PP-binding Phosphopantetheine attachment site 5.7E-10 304 365

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 321 672 3.0E-22
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 291 682 3.0E-22
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 291 752 8.0E-22
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 127 736 2.0E-19
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 317 664 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 321 672 3.0E-22
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 291 682 3.0E-22
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 291 752 8.0E-22
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 127 736 2.0E-19
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 317 664 1.0E-18
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 289 695 6.0E-15
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 324 694 7.0E-15
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 326 682 2.0E-13
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 291 662 5.0E-10
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 246 690 1.0E-09
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 109 686 1.0E-09
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 246 708 3.0E-09
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 323 665 3.0E-09
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 403 601 4.0E-09
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 425 673 2.0E-08
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 424 686 3.0E-08
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 403 601 4.0E-08
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 323 667 1.0E-07
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 426 671 3.0E-07
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 328 672 4.0E-07
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 420 682 4.0E-07
sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 424 666 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup69
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5467
Ophiocordyceps australis 1348a (Ghana) OphauG2|5656
Ophiocordyceps australis 1348a (Ghana) OphauG2|7764
Ophiocordyceps australis map64 (Brazil) OphauB2|1311
Ophiocordyceps australis map64 (Brazil) OphauB2|1430
Ophiocordyceps australis map64 (Brazil) OphauB2|1646 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4739
Ophiocordyceps camponoti-floridani Ophcf2|01223
Ophiocordyceps camponoti-rufipedis Ophun1|1554
Ophiocordyceps kimflemingae Ophio5|1785
Ophiocordyceps kimflemingae Ophio5|712
Ophiocordyceps subramaniannii Hirsu2|1787
Ophiocordyceps subramaniannii Hirsu2|1856
Ophiocordyceps subramaniannii Hirsu2|4184
Ophiocordyceps subramaniannii Hirsu2|5652
Ophiocordyceps subramaniannii Hirsu2|952

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1646
MLRYTTASWAAVSPATVDDIGRDATVLQAISESLARLAFLGGNPSLGMGNRVSRKIKICNLLGSSECGGFAQLIP
SDGLDENGQELWGYVNIHPQTNPVFEEHTPGLYELTVKRDARCEANQPVFEQRPKLQEFRTNDLFAPHPTVPGFW
QYKGRIDDMIVFLNGEKTNPLSFESYVLGHPNVKGALVFGTNRMEAGILIELADTKDGQLLLQDEKEAIGKIWPV
IEVANSFAPAHARIAESHVCFVSSGKPMLRTAKGTLKRQETLRLYADEIDGVYKKSEVVNGQPEASSIDVNNIDQ
VAEAIRCAFTSVMKRNLSSNNDDFFSLGMDSLQVIRLVRQLQRVTGLAEVKPALVYQNPSVAALSWEIANNMSTT
AKRNGTASSTQAKRLQVLHHTLQEYKGRIDELMPATRNSHAQSLQQQCTVLVTGTTGYIGSYILNELLTHPSCPN
IVCLNRSVDSKNLQASRNKLRDKSLATHFPANRVKFLTSNDTSKAKLGLCHQDFGDLLREVTLVIHNAWPVDFNL
PLSTFRASLDGLVGIINFCNMGSCSPFLILVSSISAAINQARSISETLVDSLEAPMPGYGESKFIAEHMLFEASR
KLNMRVSVVRVGQVSGAAYTPGLWNSRDWLPRMVLSSRYLGAIPEHLGALNEIDWIPIDVLAKFIIDISINPGLD
SAFEVYHAINPQVTTWPKLLPSVVHALAAHPSTFQKSTMSLISPTQWVERLRQSAVDFASDEHEEEMEARNPALK
LVDFFDETFRVVASERASWSTEISLKMSKSLRRSERIQPKWMERWVRGLL*
Coding >OphauB2|1646
ATGCTTCGATACACTACGGCGAGTTGGGCCGCTGTATCTCCAGCCACTGTGGACGACATTGGACGTGATGCAACG
GTGCTACAAGCCATTTCGGAGAGTCTCGCGAGGCTGGCTTTCCTCGGCGGCAATCCTTCTCTTGGCATGGGAAAC
AGAGTCTCACGCAAGATCAAAATTTGCAATTTGCTCGGTTCCAGCGAATGCGGAGGATTTGCACAGCTCATACCC
AGTGACGGGCTCGACGAAAACGGCCAGGAGCTCTGGGGCTATGTCAACATTCACCCTCAGACTAATCCCGTCTTT
GAAGAGCATACTCCTGGTTTGTATGAACTGACTGTGAAGCGCGACGCTCGCTGCGAGGCAAATCAACCCGTCTTT
GAGCAGCGTCCAAAACTCCAAGAGTTTAGAACAAATGACCTGTTTGCTCCTCATCCCACGGTACCAGGCTTTTGG
CAATACAAGGGAAGAATTGATGACATGATTGTATTTCTCAATGGCGAGAAGACTAACCCACTCAGCTTTGAATCT
TATGTACTGGGCCATCCAAACGTCAAGGGGGCACTCGTCTTTGGCACAAATCGTATGGAAGCCGGCATCTTGATT
GAACTCGCAGATACCAAGGATGGCCAACTCTTGTTGCAAGATGAAAAGGAAGCGATTGGCAAGATTTGGCCTGTT
ATAGAAGTGGCAAACTCTTTTGCGCCGGCCCATGCGCGCATCGCCGAGTCTCACGTCTGTTTTGTATCTTCGGGG
AAGCCAATGCTGAGAACGGCAAAGGGTACCTTGAAGCGGCAAGAAACGCTTCGGTTATATGCCGATGAAATTGAT
GGCGTCTACAAAAAGTCTGAGGTGGTCAATGGCCAACCTGAAGCAAGCTCCATTGACGTGAACAATATTGACCAA
GTCGCTGAAGCCATACGCTGCGCCTTTACTAGCGTCATGAAGCGGAATCTTTCTTCAAATAATGACGATTTTTTC
AGCCTCGGGATGGATTCCTTGCAAGTTATACGACTGGTTCGACAGCTACAAAGAGTGACGGGACTCGCAGAGGTT
AAACCCGCATTGGTCTATCAGAATCCGTCCGTTGCGGCGCTGAGTTGGGAAATTGCAAATAACATGTCCACTACA
GCCAAGAGAAATGGGACTGCATCCTCTACGCAGGCCAAGAGACTACAAGTGTTGCATCACACTCTACAAGAATAC
AAAGGCAGAATCGACGAGTTGATGCCGGCAACAAGGAATAGTCATGCGCAAAGTTTGCAGCAGCAATGCACAGTT
CTGGTCACTGGTACAACTGGCTACATAGGATCCTACATCCTAAATGAACTTCTAACTCACCCCTCTTGCCCAAAC
ATCGTCTGTCTCAACCGCTCTGTGGATTCTAAAAATCTCCAGGCATCTCGCAATAAGCTGCGAGACAAGTCTCTG
GCCACGCACTTTCCTGCCAACCGGGTCAAGTTTTTGACTTCCAACGACACGTCCAAGGCCAAGCTCGGTCTTTGC
CATCAAGACTTTGGAGACTTGCTACGGGAGGTGACGCTAGTCATCCACAACGCATGGCCCGTCGATTTTAATCTA
CCACTCTCCACCTTTAGGGCTTCGCTTGACGGGCTGGTTGGCATTATTAATTTTTGCAACATGGGAAGTTGCTCA
CCTTTTTTGATCTTGGTGTCGTCGATAAGCGCAGCAATTAATCAAGCTCGGAGTATATCAGAGACGCTCGTCGAT
AGTCTGGAAGCCCCAATGCCAGGCTATGGCGAGAGCAAATTTATTGCCGAACACATGCTGTTTGAAGCCTCTCGC
AAGCTCAACATGAGAGTGAGCGTCGTGCGTGTCGGCCAAGTCTCGGGCGCCGCTTATACCCCAGGCCTATGGAAT
AGCCGAGACTGGCTGCCTCGCATGGTGCTGAGCTCCAGATACCTCGGAGCGATTCCAGAGCATCTTGGGGCTCTC
AACGAGATTGACTGGATTCCTATCGATGTCCTGGCAAAGTTTATAATAGACATCTCCATAAACCCAGGCTTGGAT
TCGGCATTTGAGGTGTATCACGCAATAAATCCGCAAGTCACCACCTGGCCAAAACTGTTGCCCAGCGTTGTCCAT
GCTCTCGCGGCGCATCCTTCGACTTTCCAAAAGTCTACAATGTCTCTTATTTCACCTACACAGTGGGTCGAGAGA
TTACGTCAGAGTGCGGTGGACTTTGCTTCTGACGAGCACGAAGAAGAAATGGAGGCTCGCAATCCTGCACTGAAG
CTTGTCGACTTTTTTGACGAGACATTTCGGGTGGTAGCTTCAGAAAGGGCATCTTGGAGCACCGAGATTTCTCTC
AAGATGAGCAAGTCTCTGCGCAGATCAGAGCGTATTCAGCCAAAGTGGATGGAGCGCTGGGTTCGGGGCCTATTG
TGA
Transcript >OphauB2|1646
ATGCTTCGATACACTACGGCGAGTTGGGCCGCTGTATCTCCAGCCACTGTGGACGACATTGGACGTGATGCAACG
GTGCTACAAGCCATTTCGGAGAGTCTCGCGAGGCTGGCTTTCCTCGGCGGCAATCCTTCTCTTGGCATGGGAAAC
AGAGTCTCACGCAAGATCAAAATTTGCAATTTGCTCGGTTCCAGCGAATGCGGAGGATTTGCACAGCTCATACCC
AGTGACGGGCTCGACGAAAACGGCCAGGAGCTCTGGGGCTATGTCAACATTCACCCTCAGACTAATCCCGTCTTT
GAAGAGCATACTCCTGGTTTGTATGAACTGACTGTGAAGCGCGACGCTCGCTGCGAGGCAAATCAACCCGTCTTT
GAGCAGCGTCCAAAACTCCAAGAGTTTAGAACAAATGACCTGTTTGCTCCTCATCCCACGGTACCAGGCTTTTGG
CAATACAAGGGAAGAATTGATGACATGATTGTATTTCTCAATGGCGAGAAGACTAACCCACTCAGCTTTGAATCT
TATGTACTGGGCCATCCAAACGTCAAGGGGGCACTCGTCTTTGGCACAAATCGTATGGAAGCCGGCATCTTGATT
GAACTCGCAGATACCAAGGATGGCCAACTCTTGTTGCAAGATGAAAAGGAAGCGATTGGCAAGATTTGGCCTGTT
ATAGAAGTGGCAAACTCTTTTGCGCCGGCCCATGCGCGCATCGCCGAGTCTCACGTCTGTTTTGTATCTTCGGGG
AAGCCAATGCTGAGAACGGCAAAGGGTACCTTGAAGCGGCAAGAAACGCTTCGGTTATATGCCGATGAAATTGAT
GGCGTCTACAAAAAGTCTGAGGTGGTCAATGGCCAACCTGAAGCAAGCTCCATTGACGTGAACAATATTGACCAA
GTCGCTGAAGCCATACGCTGCGCCTTTACTAGCGTCATGAAGCGGAATCTTTCTTCAAATAATGACGATTTTTTC
AGCCTCGGGATGGATTCCTTGCAAGTTATACGACTGGTTCGACAGCTACAAAGAGTGACGGGACTCGCAGAGGTT
AAACCCGCATTGGTCTATCAGAATCCGTCCGTTGCGGCGCTGAGTTGGGAAATTGCAAATAACATGTCCACTACA
GCCAAGAGAAATGGGACTGCATCCTCTACGCAGGCCAAGAGACTACAAGTGTTGCATCACACTCTACAAGAATAC
AAAGGCAGAATCGACGAGTTGATGCCGGCAACAAGGAATAGTCATGCGCAAAGTTTGCAGCAGCAATGCACAGTT
CTGGTCACTGGTACAACTGGCTACATAGGATCCTACATCCTAAATGAACTTCTAACTCACCCCTCTTGCCCAAAC
ATCGTCTGTCTCAACCGCTCTGTGGATTCTAAAAATCTCCAGGCATCTCGCAATAAGCTGCGAGACAAGTCTCTG
GCCACGCACTTTCCTGCCAACCGGGTCAAGTTTTTGACTTCCAACGACACGTCCAAGGCCAAGCTCGGTCTTTGC
CATCAAGACTTTGGAGACTTGCTACGGGAGGTGACGCTAGTCATCCACAACGCATGGCCCGTCGATTTTAATCTA
CCACTCTCCACCTTTAGGGCTTCGCTTGACGGGCTGGTTGGCATTATTAATTTTTGCAACATGGGAAGTTGCTCA
CCTTTTTTGATCTTGGTGTCGTCGATAAGCGCAGCAATTAATCAAGCTCGGAGTATATCAGAGACGCTCGTCGAT
AGTCTGGAAGCCCCAATGCCAGGCTATGGCGAGAGCAAATTTATTGCCGAACACATGCTGTTTGAAGCCTCTCGC
AAGCTCAACATGAGAGTGAGCGTCGTGCGTGTCGGCCAAGTCTCGGGCGCCGCTTATACCCCAGGCCTATGGAAT
AGCCGAGACTGGCTGCCTCGCATGGTGCTGAGCTCCAGATACCTCGGAGCGATTCCAGAGCATCTTGGGGCTCTC
AACGAGATTGACTGGATTCCTATCGATGTCCTGGCAAAGTTTATAATAGACATCTCCATAAACCCAGGCTTGGAT
TCGGCATTTGAGGTGTATCACGCAATAAATCCGCAAGTCACCACCTGGCCAAAACTGTTGCCCAGCGTTGTCCAT
GCTCTCGCGGCGCATCCTTCGACTTTCCAAAAGTCTACAATGTCTCTTATTTCACCTACACAGTGGGTCGAGAGA
TTACGTCAGAGTGCGGTGGACTTTGCTTCTGACGAGCACGAAGAAGAAATGGAGGCTCGCAATCCTGCACTGAAG
CTTGTCGACTTTTTTGACGAGACATTTCGGGTGGTAGCTTCAGAAAGGGCATCTTGGAGCACCGAGATTTCTCTC
AAGATGAGCAAGTCTCTGCGCAGATCAGAGCGTATTCAGCCAAAGTGGATGGAGCGCTGGGTTCGGGGCCTATTG
TGA
Gene >OphauB2|1646
ATGCTTCGATACACTACGGCGAGTTGGGCCGCTGTATCTCCAGCCACTGTGGACGACATTGGACGTGATGCAACG
GTGCTACAAGCCATTTCGGAGAGTCTCGCGAGGCTGGCTTTCCTCGGCGGCAATCCTTCTCTTGGCATGGGAAAC
AGAGTCTCACGCAAGATCAAAATTTGCAATTTGCTCGGTTCCAGCGAATGCGGAGGATTTGCACAGCTCATACCC
AGTGACGGGCTCGACGAAAACGGCCAGGAGCTCTGGGGCTATGTCAACATTCACCCTCAGACTAATCCCGTCTTT
GAAGAGCATACTCCTGGTTTGTATGAACTGACTGTGAAGCGCGACGCTCGCTGCGAGGCAAATCAACCCGTCTTT
GAGCAGCGTCCAAAACTCCAAGAGTTTAGAACAAATGACCTGTTTGCTCCTCATCCCACGGTACCAGGCTTTTGG
CAATACAAGGGAAGAATTGATGACATGATTGTATTTCTCAATGGCGAGAAGACTAACCCACTCAGCTTTGAATCT
TATGTACTGGGCCATCCAAACGTCAAGGGGGCACTCGTCTTTGGCACAAATCGTATGGAAGCCGGCATCTTGATT
GAACTCGCAGATACCAAGGATGGCCAACTCTTGTTGCAAGATGAAAAGGAAGCGATTGGCAAGATTTGGCCTGTT
ATAGAAGTGGCAAACTCTTTTGCGCCGGCCCATGCGCGCATCGCCGAGTCTCACGTCTGTTTTGTATCTTCGGGG
AAGCCAATGCTGAGAACGGCAAAGGGTACCTTGAAGCGGCAAGAAACGCTTCGGTTATATGCCGATGAAATTGAT
GGCGTCTACAAAAAGTCTGAGGTGGTCAATGGCCAACCTGAAGCAAGCTCCATTGACGTGAACAATATTGACCAA
GTCGCTGAAGCCATACGCTGCGCCTTTACTAGCGTCATGAAGCGGAATCTTTCTTCAAATAATGACGATTTTTTC
AGCCTCGGGATGGATTCCTTGCAAGTTATACGACTGGTTCGACAGCTACAAAGAGTGACGGGACTCGCAGAGGTT
AAACCCGCATTGGTCTATCAGAATCCGTCCGTTGCGGCGCTGAGTTGGGAAATTGCAAATAACATGTCCACTACA
GCCAAGAGAAATGGGACTGCATCCTCTACGCAGGCCAAGAGACTACAAGTGTTGCATCACACTCTACAAGAATAC
AAAGGCAGAATCGACGAGTTGATGCCGGCAACAAGGAATAGTCATGCGCAAAGTTTGCAGCAGCAATGCACAGTT
CTGGTCACTGGTACAACTGGCTACATAGGATCCTACATCCTAAATGAACTTCTAACTCACCCCTCTTGCCCAAAC
ATCGTCTGTCTCAACCGCTCTGTGGATTCTAAAAATCTCCAGGCATCTCGCAATAAGCTGCGAGACAAGTCTCTG
GCCACGCACTTTCCTGCCAACCGGGTCAAGTTTTTGACTTCCAACGACACGTCCAAGGCCAAGCTCGGTCTTTGC
CATCAAGACTTTGGAGACTTGCTACGGGAGGTGACGCTAGTCATCCACAACGCATGGCCCGTCGATTTTAATCTA
CCACTCTCCACCTTTAGGGCTTCGCTTGACGGGCTGGTTGGCATTATTAATTTTTGCAACATGGGAAGTTGCTCA
CCTTTTTTGATCTTGGTGTCGTCGATAAGCGCAGCAATTAATCAAGCTCGGAGTATATCAGAGACGCTCGTCGAT
AGTCTGGAAGCCCCAATGCCAGGCTATGGCGAGAGCAAATTTATTGCCGAACACATGCTGTTTGAAGCCTCTCGC
AAGCTCAACATGAGAGTGAGCGTCGTGCGTGTCGGCCAAGTCTCGGGCGCCGCTTATACCCCAGGCCTATGGAAT
AGCCGAGACTGGCTGCCTCGCATGGTGCTGAGCTCCAGATACCTCGGAGCGATTCCAGAGCATCTTGGGGCTCTC
AACGAGATTGACTGGATTCCTATCGATGTCCTGGCAAAGTTTATAATAGACATCTCCATAAACCCAGGCTTGGAT
TCGGCATTTGAGGTGTATCACGCAATAAATCCGCAAGTCACCACCTGGCCAAAACTGTTGCCCAGCGTTGTCCAT
GCTCTCGCGGCGCATCCTTCGACTTTCCAAAAGTCTACAATGTCTCTTATTTCACCTACACAGTGGGTCGAGAGA
TTACGTCAGAGTGCGGTGGACTTTGCTTCTGACGAGCACGAAGAAGAAATGGAGGCTCGCAATCCTGCACTGAAG
CTTGTCGACTTTTTTGACGAGACATTTCGGGTGGTAGCTTCAGAAAGGGCATCTTGGAGCACCGAGATTTCTCTC
AAGATGAGCAAGTCTCTGCGCAGATCAGAGCGTATTCAGCCAAAGTGGATGGAGCGCTGGGTTCGGGGCCTATTG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail