Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1644
Gene name
LocationContig_145:44275..46163
Strand-
Gene length (bp)1888
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01039 Carboxyl_trans Carboxyl transferase domain 6.3E-77 62 537

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P05166|PCCB_HUMAN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=PCCB PE=1 SV=3 62 537 4.0E-62
sp|Q2TBR0|PCCB_BOVIN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Bos taurus GN=PCCB PE=2 SV=1 62 541 5.0E-62
sp|P79384|PCCB_PIG Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa GN=PCCB PE=2 SV=1 62 541 3.0E-61
sp|Q99MN9|PCCB_MOUSE Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Pccb PE=1 SV=2 62 541 5.0E-60
sp|P07633|PCCB_RAT Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Pccb PE=2 SV=1 62 541 4.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P05166|PCCB_HUMAN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=PCCB PE=1 SV=3 62 537 4.0E-62
sp|Q2TBR0|PCCB_BOVIN Propionyl-CoA carboxylase beta chain, mitochondrial OS=Bos taurus GN=PCCB PE=2 SV=1 62 541 5.0E-62
sp|P79384|PCCB_PIG Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa GN=PCCB PE=2 SV=1 62 541 3.0E-61
sp|Q99MN9|PCCB_MOUSE Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Pccb PE=1 SV=2 62 541 5.0E-60
sp|P07633|PCCB_RAT Propionyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Pccb PE=2 SV=1 62 541 4.0E-58
sp|P53003|PCCB_SACEN Propionyl-CoA carboxylase beta chain OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pccB PE=3 SV=2 32 533 6.0E-56
sp|Q3J4E3|PCCB_RHOS4 Propionyl-CoA carboxylase beta chain OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pccB PE=1 SV=1 36 554 2.0E-55
sp|P9WQH6|PCC5_MYCTO Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accD5 PE=3 SV=1 53 533 1.0E-52
sp|P9WQH7|PCC5_MYCTU Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accD5 PE=1 SV=1 53 533 1.0E-51
sp|P53002|PCCB_MYCLE Probable propionyl-CoA carboxylase beta chain 5 OS=Mycobacterium leprae (strain TN) GN=accD5 PE=3 SV=1 66 543 1.0E-51
sp|O31825|YNGE_BACSU Uncharacterized carboxylase YngE OS=Bacillus subtilis (strain 168) GN=yngE PE=3 SV=2 44 503 4.0E-48
sp|P54541|PCCB_BACSU Putative propionyl-CoA carboxylase beta chain OS=Bacillus subtilis (strain 168) GN=yqjD PE=3 SV=2 61 551 3.0E-47
sp|Q8GBW6|12S_PROFR Methylmalonyl-CoA carboxyltransferase 12S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=3 61 551 4.0E-46
sp|Q3ULD5|MCCB_MOUSE Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus GN=Mccc2 PE=1 SV=1 30 535 1.0E-35
sp|Q5XIT9|MCCB_RAT Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus GN=Mccc2 PE=2 SV=1 46 535 7.0E-35
sp|Q9V9A7|MCCB_DROME Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Drosophila melanogaster GN=l(2)04524 PE=2 SV=1 61 535 8.0E-35
sp|Q9LDD8|MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana GN=MCCB PE=2 SV=1 61 535 3.0E-34
sp|P34385|MCCB_CAEEL Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Caenorhabditis elegans GN=F02A9.4 PE=3 SV=1 62 535 8.0E-34
sp|Q9HCC0|MCCB_HUMAN Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens GN=MCCC2 PE=1 SV=1 66 535 2.0E-31
sp|Q8T2J9|MCCB_DICDI Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Dictyostelium discoideum GN=mccb PE=3 SV=2 33 535 2.0E-30
sp|P9WQH5|PCC6_MYCTU Probable propionyl-CoA carboxylase beta chain 6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accD6 PE=1 SV=1 227 533 4.0E-28
sp|P9WQH4|PCC6_MYCTO Probable propionyl-CoA carboxylase beta chain 6 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accD6 PE=1 SV=1 227 533 4.0E-28
sp|P63408|PCC6_MYCBO Probable propionyl-CoA carboxylase beta chain 6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accD6 PE=3 SV=1 227 533 4.0E-28
sp|Q06101|PCCB_RHOER Propionyl-CoA carboxylase beta chain OS=Rhodococcus erythropolis GN=pccB PE=3 SV=1 227 508 4.0E-19
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 202 372 2.0E-08
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 202 372 6.0E-08
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 202 372 1.0E-07
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 202 372 1.0E-07
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 202 372 2.0E-07
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 202 372 2.0E-07
sp|O00763|ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens GN=ACACB PE=1 SV=3 202 369 4.0E-07
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 104 372 6.0E-07
sp|B1WPW6|ACCA_CYAA5 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Cyanothece sp. (strain ATCC 51142) GN=accA PE=3 SV=1 319 442 6.0E-07
sp|B7JZP4|ACCA_CYAP8 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha OS=Cyanothece sp. (strain PCC 8801) GN=accA PE=3 SV=1 319 442 6.0E-07
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 253 372 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1644
MAKDDENDRQKAIERLDQVSSHLSEPKCKTLPADYSDILGQIATLRALAAKPDANHRGHVRQKQAGKLWVRERID
QLLDQGSFREIGSVSGTVVWDKTSPTSEWPASFTPGNNIQGAGMLGGRSVLLTADDFSIRSGHADGASAGKTAYV
EKLAVALRLPVVKLVDGSSGGGSVTTIRKQGWSYLPYMTLYRSVVEQLNMGIPNLGAVVGPAIGLGAARVVSCHF
SVMAADVGSLFNAGPKVVEGATFEEGLSFQDLGGPLVHCLNGTIDNLAANEAECFEQLRTILSYLPNSGSDAPPV
ISCHDAPDREDIALRSIIPRRQARMYNPRTIISSVVDEGSWFEIGALWGRTAIGGLARLGGRPVGVVSLNCEVNG
GALDAAGSQKLTRLLKMCDVMNLPILQFIDVPGYAIGTVAERTATMRWGVELAKTYFTTTTPIFSVVTRRAFGVA
GGVMLDSRDPAMQVAWPSGQWGSLPLHGGIEVGHRHELREAEKAGRKEERYKELEEEYLRLMNPVRTANAFGVQE
IIDPKDTRRVCCAWAVHVYGGLMQERLMNRACGKIHPSFA*
Coding >OphauB2|1644
ATGGCCAAAGACGACGAGAATGACAGGCAAAAGGCCATTGAGCGACTGGACCAAGTCTCGTCGCACCTCTCCGAG
CCCAAATGCAAAACTCTCCCCGCCGACTACTCAGACATTCTTGGCCAAATCGCCACACTGCGCGCCCTTGCCGCA
AAGCCAGATGCCAATCATCGAGGCCATGTGCGGCAAAAACAAGCCGGAAAGCTCTGGGTGCGCGAGCGCATCGAC
CAGCTTCTCGACCAAGGCTCGTTTCGAGAAATCGGATCCGTGTCGGGCACAGTGGTCTGGGACAAGACTTCGCCG
ACGAGTGAATGGCCCGCGTCGTTTACGCCTGGCAATAACATTCAGGGCGCGGGCATGCTTGGCGGGCGCAGCGTC
TTGCTCACGGCCGACGACTTTAGCATTCGCTCGGGCCATGCTGATGGGGCGAGTGCAGGCAAGACGGCCTATGTT
GAGAAGCTGGCAGTGGCGCTGCGCTTGCCCGTTGTCAAGCTGGTTGATGGCAGCTCGGGCGGCGGGAGTGTGACT
ACGATTCGCAAGCAGGGCTGGAGCTATCTACCGTACATGACGCTTTATAGGTCCGTCGTGGAGCAGCTGAATATG
GGTATTCCCAATCTGGGTGCCGTAGTTGGTCCTGCTATTGGTCTTGGCGCGGCAAGAGTCGTCTCGTGCCACTTT
TCCGTCATGGCGGCAGATGTTGGCTCCCTCTTCAATGCCGGCCCCAAGGTTGTCGAGGGCGCCACCTTTGAAGAG
GGCCTCAGCTTCCAAGACTTGGGCGGCCCGCTGGTCCATTGTCTCAACGGCACCATTGACAATCTCGCCGCCAAC
GAGGCCGAGTGTTTTGAGCAGCTTCGCACCATCTTGAGCTATCTCCCCAACTCGGGGAGTGACGCCCCGCCAGTA
ATATCCTGCCACGATGCTCCAGACCGCGAGGACATTGCCTTGCGCAGTATTATCCCACGCCGACAGGCCCGCATG
TATAATCCGCGAACAATCATTTCGTCCGTCGTTGATGAGGGCTCTTGGTTTGAAATTGGCGCGCTGTGGGGCCGG
ACTGCCATTGGGGGGCTTGCACGACTGGGCGGGCGTCCAGTAGGAGTCGTTTCGCTCAACTGCGAGGTCAATGGC
GGTGCGCTCGATGCGGCCGGGAGCCAGAAGCTCACTCGGCTGCTAAAGATGTGCGATGTGATGAATTTGCCCATT
TTGCAATTCATCGATGTCCCCGGCTATGCTATTGGCACCGTTGCCGAGCGCACCGCCACCATGCGCTGGGGCGTC
GAGCTAGCCAAGACGTACTTTACAACCACGACTCCAATCTTCAGCGTGGTGACTCGACGAGCATTCGGTGTGGCC
GGCGGCGTCATGCTTGACTCGCGCGATCCTGCCATGCAAGTTGCCTGGCCCTCTGGACAATGGGGCTCGCTGCCG
CTGCATGGAGGCATCGAGGTGGGCCATCGCCATGAGCTACGCGAGGCAGAAAAGGCTGGTAGGAAAGAGGAGCGG
TATAAAGAGCTGGAAGAGGAGTATCTGCGTCTGATGAATCCGGTGAGAACGGCAAATGCGTTTGGCGTGCAAGAA
ATCATTGATCCCAAGGATACGAGGCGGGTATGCTGTGCGTGGGCGGTGCATGTCTATGGCGGCCTTATGCAGGAG
AGGCTGATGAATCGAGCTTGTGGCAAGATTCATCCCTCTTTTGCTTGA
Transcript >OphauB2|1644
ATGGCCAAAGACGACGAGAATGACAGGCAAAAGGCCATTGAGCGACTGGACCAAGTCTCGTCGCACCTCTCCGAG
CCCAAATGCAAAACTCTCCCCGCCGACTACTCAGACATTCTTGGCCAAATCGCCACACTGCGCGCCCTTGCCGCA
AAGCCAGATGCCAATCATCGAGGCCATGTGCGGCAAAAACAAGCCGGAAAGCTCTGGGTGCGCGAGCGCATCGAC
CAGCTTCTCGACCAAGGCTCGTTTCGAGAAATCGGATCCGTGTCGGGCACAGTGGTCTGGGACAAGACTTCGCCG
ACGAGTGAATGGCCCGCGTCGTTTACGCCTGGCAATAACATTCAGGGCGCGGGCATGCTTGGCGGGCGCAGCGTC
TTGCTCACGGCCGACGACTTTAGCATTCGCTCGGGCCATGCTGATGGGGCGAGTGCAGGCAAGACGGCCTATGTT
GAGAAGCTGGCAGTGGCGCTGCGCTTGCCCGTTGTCAAGCTGGTTGATGGCAGCTCGGGCGGCGGGAGTGTGACT
ACGATTCGCAAGCAGGGCTGGAGCTATCTACCGTACATGACGCTTTATAGGTCCGTCGTGGAGCAGCTGAATATG
GGTATTCCCAATCTGGGTGCCGTAGTTGGTCCTGCTATTGGTCTTGGCGCGGCAAGAGTCGTCTCGTGCCACTTT
TCCGTCATGGCGGCAGATGTTGGCTCCCTCTTCAATGCCGGCCCCAAGGTTGTCGAGGGCGCCACCTTTGAAGAG
GGCCTCAGCTTCCAAGACTTGGGCGGCCCGCTGGTCCATTGTCTCAACGGCACCATTGACAATCTCGCCGCCAAC
GAGGCCGAGTGTTTTGAGCAGCTTCGCACCATCTTGAGCTATCTCCCCAACTCGGGGAGTGACGCCCCGCCAGTA
ATATCCTGCCACGATGCTCCAGACCGCGAGGACATTGCCTTGCGCAGTATTATCCCACGCCGACAGGCCCGCATG
TATAATCCGCGAACAATCATTTCGTCCGTCGTTGATGAGGGCTCTTGGTTTGAAATTGGCGCGCTGTGGGGCCGG
ACTGCCATTGGGGGGCTTGCACGACTGGGCGGGCGTCCAGTAGGAGTCGTTTCGCTCAACTGCGAGGTCAATGGC
GGTGCGCTCGATGCGGCCGGGAGCCAGAAGCTCACTCGGCTGCTAAAGATGTGCGATGTGATGAATTTGCCCATT
TTGCAATTCATCGATGTCCCCGGCTATGCTATTGGCACCGTTGCCGAGCGCACCGCCACCATGCGCTGGGGCGTC
GAGCTAGCCAAGACGTACTTTACAACCACGACTCCAATCTTCAGCGTGGTGACTCGACGAGCATTCGGTGTGGCC
GGCGGCGTCATGCTTGACTCGCGCGATCCTGCCATGCAAGTTGCCTGGCCCTCTGGACAATGGGGCTCGCTGCCG
CTGCATGGAGGCATCGAGGTGGGCCATCGCCATGAGCTACGCGAGGCAGAAAAGGCTGGTAGGAAAGAGGAGCGG
TATAAAGAGCTGGAAGAGGAGTATCTGCGTCTGATGAATCCGGTGAGAACGGCAAATGCGTTTGGCGTGCAAGAA
ATCATTGATCCCAAGGATACGAGGCGGGTATGCTGTGCGTGGGCGGTGCATGTCTATGGCGGCCTTATGCAGGAG
AGGCTGATGAATCGAGCTTGTGGCAAGATTCATCCCTCTTTTGCTTGA
Gene >OphauB2|1644
ATGGCCAAAGACGACGAGAATGACAGGCAAAAGGCCATTGAGCGACTGGACCAAGTCTCGTCGCACCTCTCCGAG
CCCAAATGCAAAACTCTCCCCGCCGACTACTCAGACATTCTTGGCCAAATCGCCACACTGCGCGCCCTTGCCGCA
AAGCCAGATGCCAATCATCGAGGCCATGTGCGGCAAAAACAAGCCGGAAAGCTCTGGGTGCGCGAGCGCATCGAC
CAGCTTCTCGACCAAGGCTCGTTTCGAGAAATCGGATCCGTGTCGGGCACAGTGGTCTGGGACAAGACTTCGCCG
ACGAGTGAATGGCCCGCGTCGTTTACGCCTGGCAATAACATTCAGGGCGCGGGCATGCTTGGCGGGCGCAGCGTC
TTGCTCACGGCCGACGACTTTAGCATTCGCTCGGGCCATGCTGATGGGGCGAGTGCAGGCAAGACGGCCTATGTT
GAGAAGCTGGCAGTGGCGCTGCGCTTGCCCGTTGTCAAGCTGGTTGATGGCAGCTCGGGCGGCGGGAGTGTGACT
ACGATTCGCAAGCAGGGCTGGAGCTATCTACCGTACATGACGCTTTATAGGTCCGTCGTGGAGCAGCTGAATATG
GGTATTCCCAATCTGGGTGCCGTAGTTGGTCCTGCTGTATGTATTTCTGTTGTCATTTGATTATTTTCATTTGAT
TATTTGTCATTTGATTACTTGCGTCTATATATATTGCTGCATCCGGGCCTTTTGCTAAGAAACAAGTCACACCCA
TAGATTGGTCTTGGCGCGGCAAGAGTCGTCTCGTGCCACTTTTCCGTCATGGCGGCAGATGTTGGCTCCCTCTTC
AATGCCGGCCCCAAGGTTGTCGAGGGCGCCACCTTTGAAGAGGGCCTCAGCTTCCAAGACTTGGGCGGCCCGCTG
GTCCATTGTCTCAACGGCACCATTGACAATCTCGCCGCCAACGAGGCCGAGTGTTTTGAGCAGCTTCGCACCATC
TTGAGCTATCTCCCCAACTCGGGGAGTGACGCCCCGCCAGTAATATCCTGCCACGATGCTCCAGACCGCGAGGAC
ATTGCCTTGCGCAGTATTATCCCACGCCGACAGGCCCGCATGTATAATCCGCGAACAATCATTTCGTCCGTCGTT
GATGAGGGCTCTTGGTTTGAAATTGGCGCGCTGTGGGGCCGGACTGCCATTGGGGGGCTTGCACGACTGGGCGGG
CGTCCAGTAGGAGTCGTTTCGCTCAACTGCGAGGTCAATGGCGGTGCGCTCGATGCGGCCGGGAGCCAGAAGCTC
ACTCGGCTGCTAAAGATGTGCGATGTGATGAATTTGCCCATTTTGCAATTCATCGATGTCCGTAAGTTGAAAATT
CCTTCTCCATTACTTGAGGATGCCTTGTAAACGGCCCTGACACTTGTCTGCTCTCTAAGCCGGCTATGCTATTGG
CACCGTTGCCGAGCGCACCGCCACCATGCGCTGGGGCGTCGAGCTAGCCAAGACGTACTTTACAACCACGACTCC
AATCTTCAGCGTGGTGACTCGACGAGCATTCGGTGTGGCCGGCGGCGTCATGCTTGACTCGCGCGATCCTGCCAT
GCAAGTTGCCTGGCCCTCTGGACAATGGGGCTCGCTGCCGCTGCATGGAGGCATCGAGGTGGGCCATCGCCATGA
GCTACGCGAGGCAGAAAAGGCTGGTAGGAAAGAGGAGCGGTATAAAGAGCTGGAAGAGGAGTATCTGCGTCTGAT
GAATCCGGTGAGAACGGCAAATGCGTTTGGCGTGCAAGAAATCATTGATCCCAAGGATACGAGGCGGGTATGCTG
TGCGTGGGCGGTGCATGTCTATGGCGGCCTTATGCAGGAGAGGCTGATGAATCGAGCTTGTGGCAAGATTCATCC
CTCTTTTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail