Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1632
Gene name
LocationContig_145:13975..14936
Strand+
Gene length (bp)961
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01738 DLH Dienelactone hydrolase family 1.5E-28 32 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39721|AIM2_YEAST Protein AIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM2 PE=1 SV=1 1 250 2.0E-42
sp|Q5XH09|CMBL_XENLA Carboxymethylenebutenolidase homolog OS=Xenopus laevis GN=cmbl PE=2 SV=1 8 251 4.0E-12
sp|Q96DG6|CMBL_HUMAN Carboxymethylenebutenolidase homolog OS=Homo sapiens GN=CMBL PE=1 SV=1 8 251 5.0E-12
sp|Q5RBU3|CMBL_PONAB Carboxymethylenebutenolidase homolog OS=Pongo abelii GN=CMBL PE=2 SV=1 8 251 6.0E-12
sp|Q7TP52|CMBL_RAT Carboxymethylenebutenolidase homolog OS=Rattus norvegicus GN=Cmbl PE=2 SV=1 7 251 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39721|AIM2_YEAST Protein AIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM2 PE=1 SV=1 1 250 2.0E-42
sp|Q5XH09|CMBL_XENLA Carboxymethylenebutenolidase homolog OS=Xenopus laevis GN=cmbl PE=2 SV=1 8 251 4.0E-12
sp|Q96DG6|CMBL_HUMAN Carboxymethylenebutenolidase homolog OS=Homo sapiens GN=CMBL PE=1 SV=1 8 251 5.0E-12
sp|Q5RBU3|CMBL_PONAB Carboxymethylenebutenolidase homolog OS=Pongo abelii GN=CMBL PE=2 SV=1 8 251 6.0E-12
sp|Q7TP52|CMBL_RAT Carboxymethylenebutenolidase homolog OS=Rattus norvegicus GN=Cmbl PE=2 SV=1 7 251 1.0E-11
sp|Q6P7K0|CMBL_XENTR Carboxymethylenebutenolidase homolog OS=Xenopus tropicalis GN=cmbl PE=2 SV=1 8 251 8.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5555
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|91
Ophiocordyceps australis map64 (Brazil) OphauB2|1632 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01294
Ophiocordyceps camponoti-rufipedis Ophun1|2648
Ophiocordyceps kimflemingae Ophio5|5542
Ophiocordyceps subramaniannii Hirsu2|7120

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1632
MASHPPGPCCTVGTLYEGEPQGESIKIGNGKIDAYLAKPPADKALTGCGIIFLPDVIGIWQNSKLLADNFAAAGY
PTLLVDLFDGDPVPLNRPASYDLMKWLRQGSDGKTPHTKEAVDPITLAGIAALREMGVAHIAAVGYCFGAKYAIR
HYKSGIECAFVAHPSFVDDEELAALSGPLSIAAAEEDFIFSTEKRHQSEEILKKTGQPYQVNLYSGVVHGFAVRG
KIEVQVERFAKEQAFRQALIWLQEFLPREG*
Coding >OphauB2|1632
ATGGCTTCGCACCCGCCAGGACCGTGCTGTACAGTAGGGACACTTTACGAGGGAGAGCCCCAGGGCGAGTCAATC
AAGATTGGCAATGGCAAAATCGACGCCTACCTGGCCAAGCCGCCTGCAGACAAGGCGCTGACGGGCTGCGGGATT
ATCTTTTTGCCCGACGTGATTGGCATTTGGCAAAACAGCAAGCTGCTGGCGGACAATTTTGCGGCGGCTGGCTAC
CCGACGCTGCTGGTTGATCTCTTTGACGGCGACCCGGTGCCTTTGAATCGTCCGGCGAGCTACGATTTGATGAAG
TGGTTGAGGCAGGGATCCGACGGCAAGACGCCACATACAAAGGAGGCGGTTGATCCGATTACTCTGGCGGGCATT
GCGGCACTGCGCGAAATGGGCGTGGCTCATATTGCTGCAGTAGGCTACTGTTTTGGAGCCAAGTACGCTATACGC
CACTACAAGAGCGGCATCGAATGCGCCTTTGTCGCCCATCCGAGCTTTGTCGACGATGAAGAGCTGGCAGCCCTC
AGTGGACCGTTGTCTATTGCAGCCGCAGAGGAGGACTTTATCTTTTCCACGGAAAAGCGCCACCAATCAGAAGAG
ATTCTCAAGAAGACGGGTCAGCCATACCAGGTGAATCTCTACAGCGGCGTGGTGCACGGCTTTGCAGTGCGGGGT
AAAATTGAAGTGCAAGTCGAGCGTTTTGCCAAGGAACAGGCTTTCCGACAGGCGCTCATTTGGCTGCAAGAGTTT
TTGCCCCGAGAGGGCTAG
Transcript >OphauB2|1632
ATGGCTTCGCACCCGCCAGGACCGTGCTGTACAGTAGGGACACTTTACGAGGGAGAGCCCCAGGGCGAGTCAATC
AAGATTGGCAATGGCAAAATCGACGCCTACCTGGCCAAGCCGCCTGCAGACAAGGCGCTGACGGGCTGCGGGATT
ATCTTTTTGCCCGACGTGATTGGCATTTGGCAAAACAGCAAGCTGCTGGCGGACAATTTTGCGGCGGCTGGCTAC
CCGACGCTGCTGGTTGATCTCTTTGACGGCGACCCGGTGCCTTTGAATCGTCCGGCGAGCTACGATTTGATGAAG
TGGTTGAGGCAGGGATCCGACGGCAAGACGCCACATACAAAGGAGGCGGTTGATCCGATTACTCTGGCGGGCATT
GCGGCACTGCGCGAAATGGGCGTGGCTCATATTGCTGCAGTAGGCTACTGTTTTGGAGCCAAGTACGCTATACGC
CACTACAAGAGCGGCATCGAATGCGCCTTTGTCGCCCATCCGAGCTTTGTCGACGATGAAGAGCTGGCAGCCCTC
AGTGGACCGTTGTCTATTGCAGCCGCAGAGGAGGACTTTATCTTTTCCACGGAAAAGCGCCACCAATCAGAAGAG
ATTCTCAAGAAGACGGGTCAGCCATACCAGGTGAATCTCTACAGCGGCGTGGTGCACGGCTTTGCAGTGCGGGGT
AAAATTGAAGTGCAAGTCGAGCGTTTTGCCAAGGAACAGGCTTTCCGACAGGCGCTCATTTGGCTGCAAGAGTTT
TTGCCCCGAGAGGGCTAG
Gene >OphauB2|1632
ATGGCTTCGCACCCGCCAGGACCGTGCTGTACAGTAGGGACACTTTACGAGTAGGTGAAATGTGCCGTGCAGACA
AGCAAAAGTGAAGCTGATGCAAAAGCCACCATTGACAGGGGAGAGCCCCAGGGCGAGTCAATCAAGATTGGCAAT
GGCAAAATCGACGCCTACCTGGCCAAGCCGCCTGCAGACAAGGCGCTGACGGGCTGCGGGATTATCTTTTTGCCC
GACGTGATTGGCATTTGGCAAAACAGCAAGCTGCTGGCGGACAATTTTGCGGCGGCTGGCTACCCGACGCTGCTG
GTTGATCTCTTTGACGGCGACCCGGTGCCTTTGAATCGTCCGGCGAGCTACGATTTGATGAAGTGGTTGAGGCAG
GGATCCGACGGCAAGACGCCACATACAAAGGAGGCGGTTGATCCGATTACTCTGGCGGGCATTGCGGCACTGCGC
GAAATGGGCGTGGCTCATATTGCTGCAGTAGGCTACTGTTTTGGAGCCAAGGCGCGTATTCCTTTTTGTTCTCGT
CTTTTTTTTTTTCCATGGACAAGTTTTGAGGAGCTCTCCATGGACACGTGTTTGACAAGGCCAGGAAGCAGCTGT
GGAGAGCAAGGAGCTAACGGCGGCTATACAGTACGCTATACGCCACTACAAGAGCGGCATCGAATGCGCCTTTGT
CGCCCATCCGAGCTTTGTCGACGATGAAGAGCTGGCAGCCCTCAGTGGACCGTTGTCTATTGCAGCCGCAGAGGA
GGACTTTATCTTTTCCACGGAAAAGCGCCACCAATCAGAAGAGATTCTCAAGAAGACGGGTCAGCCATACCAGGT
GAATCTCTACAGCGGCGTGGTGCACGGCTTTGCAGTGCGGGGTAAAATTGAAGTGCAAGTCGAGCGTTTTGCCAA
GGAACAGGCTTTCCGACAGGCGCTCATTTGGCTGCAAGAGTTTTTGCCCCGAGAGGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail