Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1620
Gene name
LocationContig_144:38889..40855
Strand+
Gene length (bp)1966
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 1.0E-35 159 412
PF06155 GBBH-like_N Gamma-butyrobetaine hydroxylase-like, N-terminal 9.2E-10 64 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UB1|TMLH_NEUCR Trimethyllysine dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-1 PE=2 SV=2 34 434 3.0E-117
sp|A5DCB6|TMLH_PICGU Trimethyllysine dioxygenase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00921 PE=3 SV=2 74 434 3.0E-82
sp|Q9NVH6|TMLH_HUMAN Trimethyllysine dioxygenase, mitochondrial OS=Homo sapiens GN=TMLHE PE=1 SV=1 74 421 5.0E-67
sp|Q91ZE0|TMLH_MOUSE Trimethyllysine dioxygenase, mitochondrial OS=Mus musculus GN=Tmlhe PE=1 SV=2 74 421 9.0E-67
sp|Q91ZW6|TMLH_RAT Trimethyllysine dioxygenase, mitochondrial OS=Rattus norvegicus GN=Tmlhe PE=1 SV=2 74 421 1.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96UB1|TMLH_NEUCR Trimethyllysine dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-1 PE=2 SV=2 34 434 3.0E-117
sp|A5DCB6|TMLH_PICGU Trimethyllysine dioxygenase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00921 PE=3 SV=2 74 434 3.0E-82
sp|Q9NVH6|TMLH_HUMAN Trimethyllysine dioxygenase, mitochondrial OS=Homo sapiens GN=TMLHE PE=1 SV=1 74 421 5.0E-67
sp|Q91ZE0|TMLH_MOUSE Trimethyllysine dioxygenase, mitochondrial OS=Mus musculus GN=Tmlhe PE=1 SV=2 74 421 9.0E-67
sp|Q91ZW6|TMLH_RAT Trimethyllysine dioxygenase, mitochondrial OS=Rattus norvegicus GN=Tmlhe PE=1 SV=2 74 421 1.0E-66
sp|Q0VC74|TMLH_BOVIN Trimethyllysine dioxygenase, mitochondrial OS=Bos taurus GN=TMLHE PE=2 SV=1 74 421 3.0E-66
sp|Q5F4B3|TMLH_CHICK Trimethyllysine dioxygenase, mitochondrial OS=Gallus gallus GN=TMLHE PE=2 SV=1 74 421 9.0E-64
sp|O75936|BODG_HUMAN Gamma-butyrobetaine dioxygenase OS=Homo sapiens GN=BBOX1 PE=1 SV=1 64 422 5.0E-35
sp|Q5R5D8|BODG_PONAB Gamma-butyrobetaine dioxygenase OS=Pongo abelii GN=BBOX1 PE=2 SV=1 64 422 9.0E-35
sp|P80193|BODG_PSESK Gamma-butyrobetaine dioxygenase OS=Pseudomonas sp. (strain AK-1) PE=1 SV=1 74 422 2.0E-31
sp|Q98KK0|BODG_RHILO Probable gamma-butyrobetaine dioxygenase OS=Rhizobium loti (strain MAFF303099) GN=mll1440 PE=3 SV=1 51 428 8.0E-31
sp|Q9QZU7|BODG_RAT Gamma-butyrobetaine dioxygenase OS=Rattus norvegicus GN=Bbox1 PE=1 SV=1 64 434 2.0E-30
sp|Q924Y0|BODG_MOUSE Gamma-butyrobetaine dioxygenase OS=Mus musculus GN=Bbox1 PE=1 SV=1 64 433 2.0E-30
sp|Q19000|BODG_CAEEL Probable gamma-butyrobetaine dioxygenase OS=Caenorhabditis elegans GN=gbh-1 PE=3 SV=1 101 422 6.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1620
MFSSVGVARRVTAGFISKWALCSRMQLPVGTCLNSARSYAVNLKPELRRVDDGLILDSADKNGDRKEEYLSADWL
RDGCACNLCINGDTQQRRLKLNEVPLNPGITSCQVTRTGFDVKWNDGHESSFSWEWILAVSNSQMQFSHRQRMWT
GQMAQDAPQVLFQDVMASGRETGMAKLLDTIRVWGFCFVNKTPVTPQATEQLLESIGPIRNTHYGAFYDFQPDLA
KADTAYTNLALPLHTDTTYFTEPAGLQAFHVLSHTPTSQPSQQLLDGETEHIPPRGSSVLADGFMAAQQLQLEAP
EEFDILTRVSVPWHCSGNEDVAIAPDRPHPVIHVRQGAYNKIRWNNSDRGYLAPGKTSAQWYKAARKWEAMLERP
SNQFWFKLEPGRVLIFDNWRVLHGRSAFEGLRRICGGYINRDDFVSRWSLTNHPRQQVIWQNMRLR*
Coding >OphauB2|1620
ATGTTTAGCTCAGTTGGCGTCGCAAGACGAGTCACTGCCGGCTTCATCTCCAAATGGGCTCTCTGCAGTCGAATG
CAGCTCCCAGTTGGCACATGTTTGAATTCAGCACGCTCGTATGCCGTGAATCTGAAGCCTGAGCTGCGTCGTGTT
GACGATGGCCTCATTCTCGACAGCGCCGACAAGAATGGAGACAGAAAGGAAGAATACCTATCTGCAGATTGGCTT
CGAGATGGCTGTGCCTGCAATCTATGCATCAATGGCGACACACAGCAAAGAAGGCTAAAGCTGAATGAGGTTCCA
CTCAACCCAGGAATTACAAGTTGCCAAGTGACGAGAACAGGCTTTGACGTAAAATGGAATGACGGACATGAAAGC
AGCTTCAGCTGGGAATGGATATTGGCCGTCAGCAACAGCCAAATGCAATTCAGCCACCGACAGCGTATGTGGACT
GGCCAGATGGCTCAAGATGCTCCCCAAGTACTCTTCCAAGACGTCATGGCTTCAGGCCGCGAGACAGGCATGGCG
AAACTTTTGGACACTATTCGCGTATGGGGATTCTGTTTCGTAAACAAGACGCCAGTGACACCTCAAGCCACAGAG
CAACTGCTCGAGAGCATAGGTCCAATTCGAAACACCCACTATGGCGCCTTCTACGACTTCCAGCCCGACTTGGCA
AAAGCTGACACGGCATACACAAACCTTGCTCTTCCCCTGCATACGGATACAACCTACTTCACAGAGCCTGCCGGC
CTCCAGGCATTCCACGTCCTATCTCACACGCCTACATCGCAGCCATCTCAGCAGCTGTTGGATGGCGAGACGGAG
CATATACCGCCTAGAGGCAGTTCGGTGCTTGCGGATGGGTTCATGGCGGCACAACAGCTCCAGTTGGAGGCACCA
GAAGAATTCGACATCTTGACCCGAGTATCGGTGCCCTGGCATTGCAGTGGCAACGAAGATGTAGCCATCGCTCCA
GACCGACCGCATCCTGTTATCCATGTCCGCCAAGGAGCATATAATAAGATACGCTGGAATAATAGCGACAGGGGT
TATTTGGCACCTGGCAAGACAAGCGCTCAATGGTACAAGGCTGCACGCAAATGGGAGGCCATGTTGGAAAGACCT
TCAAACCAGTTTTGGTTCAAACTTGAGCCTGGCCGTGTGCTGATATTCGATAACTGGCGGGTTCTTCATGGACGA
AGCGCATTTGAGGGATTGCGACGCATTTGCGGGGGATATATCAACCGTGACGACTTTGTATCACGCTGGAGCCTC
ACCAACCATCCTAGACAGCAAGTGATTTGGCAGAACATGAGACTCAGGTGA
Transcript >OphauB2|1620
ATGTTTAGCTCAGTTGGCGTCGCAAGACGAGTCACTGCCGGCTTCATCTCCAAATGGGCTCTCTGCAGTCGAATG
CAGCTCCCAGTTGGCACATGTTTGAATTCAGCACGCTCGTATGCCGTGAATCTGAAGCCTGAGCTGCGTCGTGTT
GACGATGGCCTCATTCTCGACAGCGCCGACAAGAATGGAGACAGAAAGGAAGAATACCTATCTGCAGATTGGCTT
CGAGATGGCTGTGCCTGCAATCTATGCATCAATGGCGACACACAGCAAAGAAGGCTAAAGCTGAATGAGGTTCCA
CTCAACCCAGGAATTACAAGTTGCCAAGTGACGAGAACAGGCTTTGACGTAAAATGGAATGACGGACATGAAAGC
AGCTTCAGCTGGGAATGGATATTGGCCGTCAGCAACAGCCAAATGCAATTCAGCCACCGACAGCGTATGTGGACT
GGCCAGATGGCTCAAGATGCTCCCCAAGTACTCTTCCAAGACGTCATGGCTTCAGGCCGCGAGACAGGCATGGCG
AAACTTTTGGACACTATTCGCGTATGGGGATTCTGTTTCGTAAACAAGACGCCAGTGACACCTCAAGCCACAGAG
CAACTGCTCGAGAGCATAGGTCCAATTCGAAACACCCACTATGGCGCCTTCTACGACTTCCAGCCCGACTTGGCA
AAAGCTGACACGGCATACACAAACCTTGCTCTTCCCCTGCATACGGATACAACCTACTTCACAGAGCCTGCCGGC
CTCCAGGCATTCCACGTCCTATCTCACACGCCTACATCGCAGCCATCTCAGCAGCTGTTGGATGGCGAGACGGAG
CATATACCGCCTAGAGGCAGTTCGGTGCTTGCGGATGGGTTCATGGCGGCACAACAGCTCCAGTTGGAGGCACCA
GAAGAATTCGACATCTTGACCCGAGTATCGGTGCCCTGGCATTGCAGTGGCAACGAAGATGTAGCCATCGCTCCA
GACCGACCGCATCCTGTTATCCATGTCCGCCAAGGAGCATATAATAAGATACGCTGGAATAATAGCGACAGGGGT
TATTTGGCACCTGGCAAGACAAGCGCTCAATGGTACAAGGCTGCACGCAAATGGGAGGCCATGTTGGAAAGACCT
TCAAACCAGTTTTGGTTCAAACTTGAGCCTGGCCGTGTGCTGATATTCGATAACTGGCGGGTTCTTCATGGACGA
AGCGCATTTGAGGGATTGCGACGCATTTGCGGGGGATATATCAACCGTGACGACTTTGTATCACGCTGGAGCCTC
ACCAACCATCCTAGACAGCAAGTGATTTGGCAGAACATGAGACTCAGGTGA
Gene >OphauB2|1620
ATGTTTAGCTCAGTTGGCGTCGCAAGACGAGTCACTGCCGGGTAGAGTTCATTCCAGCGACGAAGCAACTCGTGA
GTTGTGCTAAAACGAGCCAACAAGCTTCATCTCCAAATGGGCTCTCTGCAGTCGAATGCAGCTCCCAGTTGGCAC
ATGTTTGAATTCAGCACGCTCGTATGCCGTGAATCTGAAGCCTGAGCTGCGTCGTGTTGACGATGGCCTCATTCT
CGACAGCGCCGACAAGAATGGAGACAGAAAGGAAGAATACCTGTTGGTTGCTATCCTTTTGCTGCGCGTCTCCTC
CTACTTCTAACTCGAGCTTGAACAGATCTGCAGATTGGCTTCGGTGAGTGTTCTACATGTATATTGCACGGTCTA
CTGTTGACAACTTGGGCCATTAGAGATGGCTGTGCCTGCAATCTATGCATCAATGGCGACACACAGCAAAGAAGG
CTAAAGCTGAATGAGGTAAGAAGCGCATCATTGTCTCTCTGTGCGCCATTGTAGTGACTGGTGGTATTTATAGGT
TCCACTCAACCCAGGAATTACAAGTTGCCAAGTGACGAGAACAGGCTTTGACGTAAAATGTGAGTCTCGAATGCT
TCTTGTACTTGCTTCTTGTACTTGCTTCTTGTCCATTGACCATGTCAAAAACCCTCAAGGGAATGACGGACATGA
AAGCAGCTTCAGCTGGGAATGGATATTGGCCGTCAGCAACAGCCAAATGCAATTCAGCCAGTCAGTAAAGGGTCT
GAGCACATGACGAGTGAACGACATGAATATCTGATAGCCTGTACAAAAGCCGACAGCGTATGTGGACTGGCCAGA
TGGCTCAAGATGCTCCCCAAGTACTCTTCCAAGACGTCATGGCTTCAGGCCGCGAGACAGGCATGGCGAAACTTT
TGGACACTATTGTAAGTAGCAGCAACCTGACCCATATATGCATATCAAGTCCTGGAAATGCTTACAGTGACAGCG
CGTATGGGGATTCTGTTTCGTAAACAAGACGCCAGTGACACCTCAAGCCACAGAGCAACTGCTCGAGAGCATAGG
TCCAATTCGAAACACCCACTATGGCGCCTTCTACGACTTCCAGCCCGACTTGGCAAAAGCTGACACGGCATACAC
AAACCTTGCTCTTCCCCTGCATACGGATACAACCTACTTCACAGAGCCTGCCGGCCTCCAGGCATTCCACGTCCT
ATCTCACACGCCTACATCGCAGCCATCTCAGCAGCTGTTGGATGGCGAGACGGAGCATATACCGCCTAGTGCGGA
TACAGAGAGATCATTGCCATCCAGTACGAATGATGCCAAAGAAACTAATGTTGATCTAGGAGGCAGTTCGGTGCT
TGCGGATGGGTTCATGGCGGCACAACAGCTCCAGTTGGAGGCACCAGAAGAATTCGACATCTTGACCCGAGTATC
GGTGCCCTGGCATTGCAGTGGCAACGAAGATGTAGCCATCGCTCCAGACCGACCGCATCCTGTTATCCATGTCCG
CCAAGGAGCATATAATAAGATACGCTGGAATAATAGCGACAGGGGTTATTTGGCACCTGGCAAGACAAGCGCTCA
ATGGTACAAGGCTGCACGCAAATGGGAGGCCATGTTGGAAAGACCTTCAAACCAGTTTTGGTTCAAACTTGAGCC
TGGCCGTGTGCTGAGTGAGTTTTTCTCACACGTGAGGCACTGACGGATGCTGTGCCGACTGACCCCTGTTACCAC
GTGAATAGTATTCGATAACTGGCGGGTTCTTCATGGACGAAGCGCATTTGAGGGATTGCGACGCATTTGCGGGGG
ATATAGTAAGCGAGCAGTTGCCCGACGAACGGAGACTCTGCCTTGGTCTTTTCGTGTTTGTTGCTGACTGACGAT
GATAGTCAACCGTGACGACTTTGTATCACGCTGGAGCCTCACCAACCATCCTAGACAGCAAGTGATTTGGCAGAA
CATGAGACTCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail