Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1599
Gene name
LocationContig_143:35050..36410
Strand+
Gene length (bp)1360
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06441 EHN Epoxide hydrolase N terminus 4.9E-35 7 119
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.3E-11 105 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06816|HYEP_STIAD Putative epoxide hydrolase OS=Stigmatella aurantiaca (strain DW4/3-1) GN=STAUR_4299 PE=3 SV=2 4 394 5.0E-76
sp|P07099|HYEP_HUMAN Epoxide hydrolase 1 OS=Homo sapiens GN=EPHX1 PE=1 SV=1 7 390 1.0E-59
sp|P04068|HYEP_RABIT Epoxide hydrolase 1 OS=Oryctolagus cuniculus GN=EPHX1 PE=1 SV=2 7 395 2.0E-59
sp|Q8MZR5|HYEP2_CTEFE Juvenile hormone epoxide hydrolase 2 OS=Ctenocephalides felis GN=EH2 PE=2 SV=1 5 390 4.0E-59
sp|P79381|HYEP_PIG Epoxide hydrolase 1 OS=Sus scrofa GN=EPHX1 PE=2 SV=1 7 395 1.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06816|HYEP_STIAD Putative epoxide hydrolase OS=Stigmatella aurantiaca (strain DW4/3-1) GN=STAUR_4299 PE=3 SV=2 4 394 5.0E-76
sp|P07099|HYEP_HUMAN Epoxide hydrolase 1 OS=Homo sapiens GN=EPHX1 PE=1 SV=1 7 390 1.0E-59
sp|P04068|HYEP_RABIT Epoxide hydrolase 1 OS=Oryctolagus cuniculus GN=EPHX1 PE=1 SV=2 7 395 2.0E-59
sp|Q8MZR5|HYEP2_CTEFE Juvenile hormone epoxide hydrolase 2 OS=Ctenocephalides felis GN=EH2 PE=2 SV=1 5 390 4.0E-59
sp|P79381|HYEP_PIG Epoxide hydrolase 1 OS=Sus scrofa GN=EPHX1 PE=2 SV=1 7 395 1.0E-58
sp|Q8MZR6|HYEP1_CTEFE Juvenile hormone epoxide hydrolase 1 OS=Ctenocephalides felis GN=EH1 PE=1 SV=3 7 390 7.0E-58
sp|P07687|HYEP_RAT Epoxide hydrolase 1 OS=Rattus norvegicus GN=Ephx1 PE=1 SV=1 7 390 3.0E-56
sp|Q9D379|HYEP_MOUSE Epoxide hydrolase 1 OS=Mus musculus GN=Ephx1 PE=1 SV=2 7 390 2.0E-55
sp|Q6U6J0|HYEP_BOMMO Juvenile hormone epoxide hydrolase OS=Bombyx mori GN=JHEH PE=1 SV=1 2 395 1.0E-43
sp|Q25489|HYEP_MANSE Juvenile hormone epoxide hydrolase OS=Manduca sexta PE=1 SV=1 5 392 2.0E-36
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup852
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1116
Ophiocordyceps australis 1348a (Ghana) OphauG2|1222
Ophiocordyceps australis map64 (Brazil) OphauB2|1599 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6034
Ophiocordyceps subramaniannii Hirsu2|4643
Ophiocordyceps subramaniannii Hirsu2|7148

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1599
MSHTSGVEPFKISVPEKALDALREKLAKASFPETVDFSDDWEYGAPQSHVQRLAKYWKDGFDWRAQEARLNAALP
QFTTEIDIDGFGPLRVHLVHKESSRPGSIPLLFCHGWPGSFIEVVKVLPLLVDPAEGPSFHVVAPSLPNFGFSHV
VKKRGFGIPQYAECMHKVMAKLGYNKYVTQGGDWGAIITRMMGVLYPEHCLASHVNFLVVRPSIPQYLTLALTHA
FKWCTGWHSQLERGRLARSFWYLTQGSGYMMVQANQPANIGLAFADSPVALLAWVYEKLHNWTDEYPWTDDEVLT
WISIYQFSTAGAAASVRIYYEAYHSQRDTTMKCARYVPRVPLGISYFPKDLLAPPRDVGRAAGPVVFEAEHDQGG
HFAAYECPQQLCKDIGAMFGPEGGACHVAQRFQHTTLS*
Coding >OphauB2|1599
ATGTCGCACACGAGTGGAGTCGAACCTTTTAAAATCTCCGTGCCGGAGAAGGCGCTCGACGCGCTGCGGGAGAAG
CTGGCAAAGGCATCGTTTCCAGAGACGGTTGACTTTTCTGATGATTGGGAATATGGCGCGCCGCAAAGCCATGTG
CAGCGACTGGCAAAGTATTGGAAGGATGGGTTTGACTGGCGCGCGCAAGAGGCTCGGTTGAATGCCGCGCTGCCG
CAGTTTACCACGGAGATTGACATTGATGGCTTTGGGCCGCTGCGTGTACACTTGGTGCACAAGGAGAGCAGTCGG
CCGGGGAGTATTCCGCTGCTCTTTTGCCATGGGTGGCCGGGAAGCTTTATCGAAGTCGTAAAGGTGCTTCCGCTG
CTGGTTGATCCGGCTGAGGGACCGTCATTTCATGTAGTTGCGCCCTCGCTGCCCAACTTTGGCTTTTCCCATGTT
GTGAAGAAGAGGGGATTCGGGATCCCGCAATATGCGGAATGCATGCATAAAGTCATGGCAAAACTCGGCTACAAT
AAATACGTAACCCAAGGAGGCGACTGGGGCGCCATCATTACTCGAATGATGGGCGTGCTCTATCCTGAACACTGT
CTCGCTTCTCACGTCAACTTTCTCGTCGTCAGGCCCTCGATTCCTCAATATCTCACCTTGGCCCTCACCCACGCC
TTTAAATGGTGCACCGGCTGGCACTCCCAGCTTGAACGAGGGCGTCTTGCCCGCAGCTTTTGGTATCTCACCCAA
GGCTCCGGCTACATGATGGTCCAGGCCAACCAGCCGGCAAACATTGGCCTCGCCTTTGCCGACTCGCCCGTTGCC
CTGCTCGCCTGGGTCTACGAGAAGCTGCACAACTGGACAGACGAGTATCCGTGGACAGACGATGAGGTCTTGACG
TGGATCTCCATTTACCAATTCTCAACTGCCGGCGCGGCTGCCAGCGTTCGCATCTACTACGAAGCCTATCATTCT
CAGCGGGACACCACCATGAAGTGCGCTCGATATGTGCCGCGCGTTCCCTTGGGAATCTCCTACTTTCCCAAAGAC
CTCTTGGCACCCCCGCGAGATGTCGGACGTGCAGCAGGGCCCGTCGTCTTTGAGGCTGAGCACGACCAAGGTGGC
CACTTTGCCGCCTACGAGTGTCCCCAACAGCTTTGCAAAGACATTGGTGCCATGTTTGGGCCCGAGGGGGGCGCT
TGTCATGTAGCTCAAAGATTTCAGCATACTACACTCTCATGA
Transcript >OphauB2|1599
ATGTCGCACACGAGTGGAGTCGAACCTTTTAAAATCTCCGTGCCGGAGAAGGCGCTCGACGCGCTGCGGGAGAAG
CTGGCAAAGGCATCGTTTCCAGAGACGGTTGACTTTTCTGATGATTGGGAATATGGCGCGCCGCAAAGCCATGTG
CAGCGACTGGCAAAGTATTGGAAGGATGGGTTTGACTGGCGCGCGCAAGAGGCTCGGTTGAATGCCGCGCTGCCG
CAGTTTACCACGGAGATTGACATTGATGGCTTTGGGCCGCTGCGTGTACACTTGGTGCACAAGGAGAGCAGTCGG
CCGGGGAGTATTCCGCTGCTCTTTTGCCATGGGTGGCCGGGAAGCTTTATCGAAGTCGTAAAGGTGCTTCCGCTG
CTGGTTGATCCGGCTGAGGGACCGTCATTTCATGTAGTTGCGCCCTCGCTGCCCAACTTTGGCTTTTCCCATGTT
GTGAAGAAGAGGGGATTCGGGATCCCGCAATATGCGGAATGCATGCATAAAGTCATGGCAAAACTCGGCTACAAT
AAATACGTAACCCAAGGAGGCGACTGGGGCGCCATCATTACTCGAATGATGGGCGTGCTCTATCCTGAACACTGT
CTCGCTTCTCACGTCAACTTTCTCGTCGTCAGGCCCTCGATTCCTCAATATCTCACCTTGGCCCTCACCCACGCC
TTTAAATGGTGCACCGGCTGGCACTCCCAGCTTGAACGAGGGCGTCTTGCCCGCAGCTTTTGGTATCTCACCCAA
GGCTCCGGCTACATGATGGTCCAGGCCAACCAGCCGGCAAACATTGGCCTCGCCTTTGCCGACTCGCCCGTTGCC
CTGCTCGCCTGGGTCTACGAGAAGCTGCACAACTGGACAGACGAGTATCCGTGGACAGACGATGAGGTCTTGACG
TGGATCTCCATTTACCAATTCTCAACTGCCGGCGCGGCTGCCAGCGTTCGCATCTACTACGAAGCCTATCATTCT
CAGCGGGACACCACCATGAAGTGCGCTCGATATGTGCCGCGCGTTCCCTTGGGAATCTCCTACTTTCCCAAAGAC
CTCTTGGCACCCCCGCGAGATGTCGGACGTGCAGCAGGGCCCGTCGTCTTTGAGGCTGAGCACGACCAAGGTGGC
CACTTTGCCGCCTACGAGTGTCCCCAACAGCTTTGCAAAGACATTGGTGCCATGTTTGGGCCCGAGGGGGGCGCT
TGTCATGTAGCTCAAAGATTTCAGCATACTACACTCTCATGA
Gene >OphauB2|1599
ATGTCGCACACGAGTGGAGTCGAACCTTTTAAAATCTCCGTGCCGGAGAAGGCGCTCGACGCGCTGCGGGAGAAG
CTGGCAAAGGCATCGTTTCCAGAGACGGTTGACTTTTCTGATGATTGGGAATATGGCGCGCCGCAAAGCCATGTG
CAGCGACTGGCAAAGTATTGGAAGGATGGGTTTGACTGGCGCGCGCAAGAGGCTCGGTTGAATGCCGCGCTGCCG
CAGTTTACCACGGAGATTGACATTGATGGCTTTGGGCCGCTGCGTGTACACTTGGTGCACAAGGAGAGCAGTCGG
CCGGGGAGTATTCCGCTGCTCTTTTGCCATGGGTGTAAGGTCTGCCTTGATTTGGGTGGGTGCAGAGTTTGACTG
ACGGTTGGTAGGGCCGGGAAGCTTTATCGAAGTCGTAAAGGTGCTTCCGCTGCTGGTTGATCCGGCTGAGGGACC
GTCATTTCATGTAGTTGCGCCCTCGCTGCCCAACTTTGGCTTTTCCCATGTTGTGAAGAAGAGGGGATTCGGGAT
CCCGCAATATGCGGAATGCATGCATAAAGTCATGGCAAAACTCGGCTACAATAAATACGGTACGCCATTTTACGT
GTCAGCTATCCATTGCCATGGCAGTTGCTGACTGAGAGACAAAAAAACAGTAACCCAAGGAGGCGACTGGGGCGC
CATCATTACTCGAATGATGGGCGTGCTCTATCCTGAACACTGTCTCGCTTCTCACGTCAACTTTCTCGTCGTCAG
GCCCTCGATTCCTCAATATCTCACCTTGGCCCTCACCCACGCCTTTAAATGGTGCACCGGCTGGCACTCCCAGCT
TGAACGAGGGCGTCTTGCCCGCAGCTTTTGGTATCTCACCCAAGGCTCCGGCTACATGATGGTCCAGGCCAACCA
GCCGGCAAACATTGGCCTCGCCTTTGCCGACTCGCCCGTTGCCCTGCTCGCCTGGGTCTACGAGAAGCTGCACAA
CTGGACAGACGAGTATCCGTGGACAGACGATGAGGTCTTGACGTGGATCTCCATTTACCAATTCTCAACTGCCGG
CGCGGCTGCCAGCGTTCGCATCTACTACGAAGCCTATCATTCTCAGCGGGACACCACCATGAAGTGCGCTCGATA
TGTGCCGCGCGTTCCCTTGGGAATCTCCTACTTTCCCAAAGACCTCTTGGCACCCCCGCGAGATGTCGGACGTGC
AGCAGGGCCCGTCGTCTTTGAGGCTGAGCACGACCAAGGTGGCCACTTTGCCGCCTACGAGTGTCCCCAACAGCT
TTGCAAAGACATTGGTGCCATGTTTGGGCCCGAGGGGGGCGCTTGTCATGTAGCTCAAAGATTTCAGCATACTAC
ACTCTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail