Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1595
Gene name
LocationContig_143:19511..21195
Strand-
Gene length (bp)1684
Transcript length (bp)1266
Coding sequence length (bp)1266
Protein length (aa) 422

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.2E-18 4 366
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.3E-06 7 41

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 1 371 2.0E-35
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 18 374 6.0E-30
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 23 372 7.0E-30
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 3 368 7.0E-28
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 18 371 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 1 371 2.0E-35
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 18 374 6.0E-30
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 23 372 7.0E-30
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 3 368 7.0E-28
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 18 371 2.0E-24
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 28 372 4.0E-23
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 27 371 7.0E-22
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 97 366 3.0E-17
sp|Q8NLB6|3HBH_CORGL 3-hydroxybenzoate 6-hydroxylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl3026 PE=1 SV=1 28 370 3.0E-11
sp|A8LVF4|KMO_SALAI Kynurenine 3-monooxygenase OS=Salinispora arenicola (strain CNS-205) GN=kmo PE=3 SV=1 9 342 8.0E-11
sp|O06489|YETM_BACSU Putative oxidoreductase YetM OS=Bacillus subtilis (strain 168) GN=yetM PE=3 SV=1 154 377 7.0E-10
sp|A4XD40|KMO_SALTO Kynurenine 3-monooxygenase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=kmo PE=3 SV=1 9 342 5.0E-08
sp|Q84HF5|KMO_PSEFL Kynurenine 3-monooxygenase OS=Pseudomonas fluorescens GN=kmo PE=1 SV=1 4 342 8.0E-08
sp|Q11PP7|KMO_CYTH3 Kynurenine 3-monooxygenase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=kmo PE=1 SV=1 1 340 1.0E-07
sp|P42534|HYDL_STRCO Putative polyketide hydroxylase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5321 PE=3 SV=2 151 364 2.0E-06
sp|Q9S3U9|VIOC_CHRVO Probable monooxygenase VioC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=vioC PE=1 SV=2 143 412 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043167 ion binding No
GO:0048037 cofactor binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1595
MPLEIAIIGGGIAGLTAAISLRRSNHKVQIYESSAFAGEVGAALNLTPNGVQVLQKLGFDFERARAVQVVNWDTV
NGVNLKRIVCQDLSAAKDMFGAPFFAVHRVDLHTELMRLANVSQVQGPAAQHDGAVIPLHLASAVARIDAAAGRI
EFADGTVKHADVIVGADGVRSVVRNAVVGDAQQAELLPTGQGAFRFLVSTKELQATAAGRELLKWKMPGACLLAD
PTIEDKERHIMWYPCRDGSVQNFVGIHPTTESSGLVTDACERMIEQFGHYDEKVVEILKNAKDTKFWPLFSMKPL
ASWTSGKALLIGDAAHPMLPFGGQGSNQAIEDGGVLGSVLASAKEPAELEERLQLFNSLRVPRASRAQILSSVRV
NKEHLVVDRIREYMEPGVPLPDSFPKRILHDSRFDALGHCAEALRI*
Coding >OphauB2|1595
ATGCCTTTGGAAATCGCCATTATTGGGGGTGGAATTGCAGGTCTCACTGCTGCCATTTCTCTCAGACGCAGCAAT
CACAAAGTGCAGATTTACGAAAGCTCCGCCTTTGCTGGCGAAGTTGGCGCAGCGCTCAATTTGACCCCCAATGGC
GTCCAAGTCCTTCAGAAACTCGGCTTCGACTTTGAGCGAGCCCGAGCCGTCCAAGTGGTAAATTGGGATACGGTC
AATGGGGTCAATTTGAAGCGCATCGTTTGCCAGGACCTGAGTGCTGCCAAGGACATGTTTGGCGCTCCATTCTTC
GCCGTGCACCGGGTAGATCTTCACACGGAGCTCATGAGACTAGCCAACGTCTCGCAGGTTCAAGGCCCCGCGGCG
CAGCATGATGGAGCCGTCATCCCTCTTCATCTGGCATCTGCAGTGGCTAGAATCGATGCCGCCGCAGGACGCATC
GAGTTTGCCGACGGGACTGTCAAGCATGCAGATGTTATTGTGGGCGCTGATGGTGTGCGCTCAGTCGTTCGCAAT
GCCGTGGTTGGAGATGCGCAACAGGCTGAGCTGCTTCCTACGGGCCAAGGTGCTTTTCGCTTCTTGGTGTCAACT
AAAGAGCTGCAGGCGACGGCGGCTGGTCGCGAGCTGCTCAAATGGAAGATGCCTGGAGCATGCTTGCTAGCTGAC
CCTACGATTGAGGATAAGGAGCGACATATTATGTGGTATCCCTGTAGAGACGGCTCAGTACAAAATTTTGTCGGC
ATTCATCCGACTACAGAGTCTTCAGGCTTGGTGACAGACGCATGCGAGCGCATGATTGAACAATTTGGGCATTAT
GACGAAAAGGTTGTCGAGATTCTCAAAAATGCCAAAGACACCAAATTTTGGCCGCTCTTTTCCATGAAGCCGCTT
GCATCCTGGACCTCTGGAAAAGCTCTACTGATTGGCGACGCAGCTCATCCTATGCTTCCGTTTGGCGGACAGGGT
TCCAATCAAGCCATTGAGGATGGCGGCGTCCTGGGAAGTGTCTTGGCGAGCGCCAAGGAACCCGCCGAGCTGGAG
GAGCGACTGCAGCTGTTTAACAGCCTACGAGTCCCGCGAGCGTCGCGAGCACAGATATTATCCAGCGTCCGTGTC
AACAAAGAACACCTTGTTGTAGACCGAATACGCGAATACATGGAGCCCGGAGTGCCTTTGCCCGATTCGTTTCCC
AAGCGTATTCTTCATGATTCACGATTTGATGCTTTGGGACACTGTGCAGAGGCATTGAGGATATGA
Transcript >OphauB2|1595
ATGCCTTTGGAAATCGCCATTATTGGGGGTGGAATTGCAGGTCTCACTGCTGCCATTTCTCTCAGACGCAGCAAT
CACAAAGTGCAGATTTACGAAAGCTCCGCCTTTGCTGGCGAAGTTGGCGCAGCGCTCAATTTGACCCCCAATGGC
GTCCAAGTCCTTCAGAAACTCGGCTTCGACTTTGAGCGAGCCCGAGCCGTCCAAGTGGTAAATTGGGATACGGTC
AATGGGGTCAATTTGAAGCGCATCGTTTGCCAGGACCTGAGTGCTGCCAAGGACATGTTTGGCGCTCCATTCTTC
GCCGTGCACCGGGTAGATCTTCACACGGAGCTCATGAGACTAGCCAACGTCTCGCAGGTTCAAGGCCCCGCGGCG
CAGCATGATGGAGCCGTCATCCCTCTTCATCTGGCATCTGCAGTGGCTAGAATCGATGCCGCCGCAGGACGCATC
GAGTTTGCCGACGGGACTGTCAAGCATGCAGATGTTATTGTGGGCGCTGATGGTGTGCGCTCAGTCGTTCGCAAT
GCCGTGGTTGGAGATGCGCAACAGGCTGAGCTGCTTCCTACGGGCCAAGGTGCTTTTCGCTTCTTGGTGTCAACT
AAAGAGCTGCAGGCGACGGCGGCTGGTCGCGAGCTGCTCAAATGGAAGATGCCTGGAGCATGCTTGCTAGCTGAC
CCTACGATTGAGGATAAGGAGCGACATATTATGTGGTATCCCTGTAGAGACGGCTCAGTACAAAATTTTGTCGGC
ATTCATCCGACTACAGAGTCTTCAGGCTTGGTGACAGACGCATGCGAGCGCATGATTGAACAATTTGGGCATTAT
GACGAAAAGGTTGTCGAGATTCTCAAAAATGCCAAAGACACCAAATTTTGGCCGCTCTTTTCCATGAAGCCGCTT
GCATCCTGGACCTCTGGAAAAGCTCTACTGATTGGCGACGCAGCTCATCCTATGCTTCCGTTTGGCGGACAGGGT
TCCAATCAAGCCATTGAGGATGGCGGCGTCCTGGGAAGTGTCTTGGCGAGCGCCAAGGAACCCGCCGAGCTGGAG
GAGCGACTGCAGCTGTTTAACAGCCTACGAGTCCCGCGAGCGTCGCGAGCACAGATATTATCCAGCGTCCGTGTC
AACAAAGAACACCTTGTTGTAGACCGAATACGCGAATACATGGAGCCCGGAGTGCCTTTGCCCGATTCGTTTCCC
AAGCGTATTCTTCATGATTCACGATTTGATGCTTTGGGACACTGTGCAGAGGCATTGAGGATATGA
Gene >OphauB2|1595
ATGCCTTTGGAAATCGCCATTATTGGGGGTGGAATTGCAGGTCTCACTGCTGCCATTTCTCTCAGACGCAGCAAT
CACAAAGTGCAGGTGAGTGTTTCTTTGCTCAAGGAATAGTCAAGAAATTAGAATTGTTGACAGTGTACTTGCTAG
ATTTACGAAAGCTCCGCCTTTGCTGGCGAAGTTGGCGCAGCGCTCAATTTGACCCCCAATGGCGTCCAAGTCCTT
CAGAAACTCGGCTTCGACTTTGAGCGAGCCCGAGCCGTCCAAGTGGTAAATTGGGATACGGTCAATGGGGTCAAT
TTGAAGCGCATCGTTTGCCAGGACCTGAGTGCTGCCAAGGACATGTTTGGCGCTCCATTCTTCGCCGTGCACCGG
GTAGATCTTCACACGGAGCTCATGAGACTAGCCAACGTCTCGCAGGTTCAAGGCCCCGCGGCGCAGCATGATGGA
GCCGTCATCCCTCTTCATCTGGCATCTGCAGTGGCTAGAATCGATGCCGCCGCAGGACGCATCGAGTTTGCCGAC
GGGACTGTCAAGCATGCAGATGTTATTGTGGGCGCTGATGGTGTGCGCTCAGTCGTTCGCAATGCCGTGGTTGGA
GATGCGCAACAGGCTGAGCTGCTTCCTACGGGCCAAGGTGCTTTTCGCTTCTTGGTGTCAACTAAAGAGCTGCAG
GCGACGGCGGCTGGTCGCGAGCTGCTCAAATGGAAGATGCCTGGAGCATGCTTGCTAGCTGACCCTACGATTGAG
GATAAGGAGCGACATATTATGTGGTATCCCTGTAGAGAGTATGTATGCATCTACGTGTCAAGTCGTGCAGCAGAT
GTACTAATATCGTGATTGTAGCGGCTCAGTACAAAATTTTGTCGGCATTCATCCGACTACAGAGTCTTCAGGCTT
GGTGACAGGTGAGTCAATAGTCGGTGTTTGTGAAAGACATGTAGCTGGCTGGTACTAATTTTGCGTTTCTGCAGA
CGCATGCGAGCGCATGATTGAACAATTTGGGCATTATGACGAAAAGGTTGTCGAGATTCTCAAGTACGTTGACCC
TAAGACACTGACTGATGAATTATTAACGCTGGATAGAAATGCCAAAGACACCAAATTTTGGCCGCTCTTTTCCAT
GAAGCCGCTTGCATCCTGGACCTCTGGAAAAGCTCTACTGATTGGCGACGCAGCTCATCCTGTAAGAAGCAATTT
TGAACCATTACTATGCCCCGTCTCTAATGTTGCTTGGGTGATGCAGATGCTTCCGTTTGGCGGACAGGGTTCCAA
TCAAGCCATTGAGGATGGCGGCGTCCTGGGAAGTGTCTTGGCGAGCGCCAAGGAACCCGCCGAGCTGGAGGAGCG
ACTGCAGCTGTTTAACAGCCTACGAGTCCCGCGAGCGTCGCGAGCACAGATATTATCCAGCGTCCGTGTCAACAA
AGAACACCTTGTTGTAGACCGAATACGCGAATACATGGAGCCCGGAGTGCCTTGTGAGTAGAGACTTGAAGGAGC
CGTGGCTTGGATAGGAGCTTATTTTACTGGATTTTTAGTGCCCGATTCGTTTCCCAAGCGTATTCTTCATGATTC
ACGGTACGTCTAAACGTTTGATAAGAATATGACTGGAGCTGGAGTAGCAGCTAATGTTTTATTTAGATTTGATGC
TTTGGGACACTGTGCAGAGGCATTGAGGATATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail