Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1592
Gene name
LocationContig_143:9768..11201
Strand+
Gene length (bp)1433
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 86 108 22
3 121 143 22
4 153 175 22
5 195 217 22
6 232 254 22
7 275 297 22
8 312 329 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1592
MSTMATRITLFFLLATASVHGITPQLFTIQNTAITPLATPPPIARGPLAAAPPQPTPPSPAPQTIQPEAKVTEAP
KKAVLGGIPTTSLDVPLTLVFLFFFGFGAYLHITTYKANSKRGHKFLLSSLLFDFCMVRVTTFIFRILWALVPLP
GIILVANIFQNGGAVVVAAVNLIFAQRLVRAMHPRIGWGRIFSRYSLLLIWTCPGITVINIITISVNHFSVGKPT
QLHVTESILKFGSCWNMMLVATPLLWVFAACAKPGPPPDNFGQGDLSSKAALLVFSAATMTVGAAVRLTISVNTE
VPEYLLGKGTLYTTQFLLEIMTVALYAYFRVDLLFHIPNGASKPGDYSGNVDLNAKPQLWTTRDIEGAIDKLGVG
YEILTSKQRNGQGPVLALLYPACAGQYGVEEKTSVIVSEYPRNMSDRSLHKGLPPIRPERAPRGSLYMTERRCSE
ELYPMSFV*
Coding >OphauB2|1592
ATGTCAACCATGGCCACCCGCATCACCCTTTTTTTCCTCCTAGCCACCGCCTCTGTCCACGGCATCACTCCCCAA
CTCTTTACCATTCAAAATACTGCCATCACACCTCTTGCTACCCCCCCTCCCATTGCTAGAGGACCTCTTGCCGCT
GCTCCTCCCCAGCCAACCCCCCCCTCTCCAGCACCGCAAACAATCCAGCCAGAAGCAAAAGTAACCGAGGCGCCC
AAAAAGGCCGTCTTGGGAGGCATTCCCACCACTAGTCTTGATGTTCCCCTCACCCTCGTCTTTCTCTTCTTCTTT
GGCTTTGGAGCATACCTTCACATCACCACTTACAAGGCCAACTCGAAGCGCGGGCACAAGTTTCTCCTGTCGAGC
CTCTTGTTTGATTTTTGCATGGTTCGCGTCACGACATTCATCTTTCGCATCCTCTGGGCTCTTGTGCCTCTGCCA
GGTATTATTCTCGTGGCCAATATTTTTCAAAACGGCGGAGCCGTTGTCGTTGCTGCTGTAAACTTGATTTTTGCT
CAACGCCTCGTCCGCGCCATGCACCCCCGGATTGGCTGGGGCCGCATTTTTAGTCGCTACTCCCTTCTTCTCATC
TGGACCTGTCCCGGCATCACCGTCATCAACATTATTACCATTTCCGTCAACCATTTCAGCGTCGGGAAACCCACG
CAGCTACATGTGACTGAGTCTATTCTCAAATTCGGCTCTTGCTGGAACATGATGCTCGTCGCCACCCCGCTGCTA
TGGGTTTTTGCCGCGTGCGCCAAGCCAGGTCCGCCGCCAGACAATTTTGGCCAGGGAGACTTGAGCTCCAAGGCG
GCGCTCCTCGTCTTTAGTGCCGCAACCATGACTGTCGGCGCGGCAGTGCGGTTGACGATTTCGGTGAATACAGAG
GTTCCGGAATATCTGCTCGGCAAGGGTACGCTTTATACGACGCAGTTTCTGCTTGAGATTATGACTGTGGCGCTG
TATGCTTACTTTCGTGTCGACTTGCTCTTTCATATCCCCAATGGTGCGAGCAAGCCGGGAGACTACTCTGGCAAT
GTCGACTTGAATGCCAAGCCGCAGCTGTGGACGACGCGTGATATCGAGGGCGCAATTGACAAGCTTGGTGTGGGC
TATGAGATTTTGACGTCAAAGCAGAGGAATGGGCAAGGACCAGTCTTGGCGTTGCTGTATCCGGCTTGTGCTGGG
CAGTATGGCGTCGAGGAAAAGACGTCGGTTATAGTGTCCGAGTATCCGCGGAATATGTCGGACAGGAGTCTGCAC
AAGGGGCTGCCGCCAATTCGGCCTGAGCGGGCGCCAAGAGGGTCTCTTTACATGACTGAGCGACGATGTTCTGAG
GAGCTGTATCCAATGTCGTTTGTCTAG
Transcript >OphauB2|1592
ATGTCAACCATGGCCACCCGCATCACCCTTTTTTTCCTCCTAGCCACCGCCTCTGTCCACGGCATCACTCCCCAA
CTCTTTACCATTCAAAATACTGCCATCACACCTCTTGCTACCCCCCCTCCCATTGCTAGAGGACCTCTTGCCGCT
GCTCCTCCCCAGCCAACCCCCCCCTCTCCAGCACCGCAAACAATCCAGCCAGAAGCAAAAGTAACCGAGGCGCCC
AAAAAGGCCGTCTTGGGAGGCATTCCCACCACTAGTCTTGATGTTCCCCTCACCCTCGTCTTTCTCTTCTTCTTT
GGCTTTGGAGCATACCTTCACATCACCACTTACAAGGCCAACTCGAAGCGCGGGCACAAGTTTCTCCTGTCGAGC
CTCTTGTTTGATTTTTGCATGGTTCGCGTCACGACATTCATCTTTCGCATCCTCTGGGCTCTTGTGCCTCTGCCA
GGTATTATTCTCGTGGCCAATATTTTTCAAAACGGCGGAGCCGTTGTCGTTGCTGCTGTAAACTTGATTTTTGCT
CAACGCCTCGTCCGCGCCATGCACCCCCGGATTGGCTGGGGCCGCATTTTTAGTCGCTACTCCCTTCTTCTCATC
TGGACCTGTCCCGGCATCACCGTCATCAACATTATTACCATTTCCGTCAACCATTTCAGCGTCGGGAAACCCACG
CAGCTACATGTGACTGAGTCTATTCTCAAATTCGGCTCTTGCTGGAACATGATGCTCGTCGCCACCCCGCTGCTA
TGGGTTTTTGCCGCGTGCGCCAAGCCAGGTCCGCCGCCAGACAATTTTGGCCAGGGAGACTTGAGCTCCAAGGCG
GCGCTCCTCGTCTTTAGTGCCGCAACCATGACTGTCGGCGCGGCAGTGCGGTTGACGATTTCGGTGAATACAGAG
GTTCCGGAATATCTGCTCGGCAAGGGTACGCTTTATACGACGCAGTTTCTGCTTGAGATTATGACTGTGGCGCTG
TATGCTTACTTTCGTGTCGACTTGCTCTTTCATATCCCCAATGGTGCGAGCAAGCCGGGAGACTACTCTGGCAAT
GTCGACTTGAATGCCAAGCCGCAGCTGTGGACGACGCGTGATATCGAGGGCGCAATTGACAAGCTTGGTGTGGGC
TATGAGATTTTGACGTCAAAGCAGAGGAATGGGCAAGGACCAGTCTTGGCGTTGCTGTATCCGGCTTGTGCTGGG
CAGTATGGCGTCGAGGAAAAGACGTCGGTTATAGTGTCCGAGTATCCGCGGAATATGTCGGACAGGAGTCTGCAC
AAGGGGCTGCCGCCAATTCGGCCTGAGCGGGCGCCAAGAGGGTCTCTTTACATGACTGAGCGACGATGTTCTGAG
GAGCTGTATCCAATGTCGTTTGTCTAG
Gene >OphauB2|1592
ATGTCAACCATGGCCACCCGCATCACCCTTTTTTTCCTCCTAGCCACCGCCTCTGTCCACGGCATCACTCCCCAA
CTCTTTACCATTCAAAATACTGCCATCACACCTCTTGCTACCCCCCCTCCCATTGCTAGAGGACCTCTTGCCGCT
GCTCCTCCCCAGCCAACCCCCCCCTCTCCAGCACCGCAAACAATCCAGCCAGAAGCAAAAGTAACCGAGGCGCCC
AAAAAGGCCGTCTTGGGAGGCATTCCCACCACTAGTCTTGATGTTCCCCTCACCCTCGTCTTTCTCTTCTTCTTT
GGCTTTGGAGCATACCTTCACATCACCACTTACAAGGCCAACTCGAAGCGCGGGCACAAGTTTCTCCTGTCGAGC
CTCTTGTTTGATTTTTGCATGGTTCGCGTCACGACATTCATCTTTCGCATCCTCTGGGCTCTTGTGCCTCTGCCA
GGTATTATTCTCGTGGCCAATATTTTTCAAAACGGCGGGTAAGTCTTGCCTACTCCCAGCCCTTGCATATACCAC
CCGTCTTAACAAAACATAGAGCCGTTGTCGTTGCTGCTGTAAACTTGATTTTTGCTCAACGCCTCGTCCGCGCCA
TGCACCCCCGGATTGGCTGGGGCCGCATTTTTAGTCGCTACTCCCTTCTTCTCATCTGGACCTGTCCCGGCATCA
CCGTCATCAACATTATTACCATTTCCGTCAACCATTTCAGCGTCGGGAAACCCACGCAGCTACATGTGACTGAGT
CTATTCTCAAATTCGGCTCTTGCTGGAACATGATGCTCGTCGCCACCCCGCTGCTATGGGTTTTTGCCGCGTGCG
CCAAGCCAGGTCCGCCGCCAGACAATTTTGGCCAGGGAGACTTGAGCTCCAAGGCGGCGCTCCTCGTCTTTAGTG
CCGCAACCATGACTGTCGGCGCGGCAGTGCGGTTGACGATTTCGGTGAATACAGAGGTTCCGGAATATCTGCTCG
GCAAGGGTACGCTTTATACGACGCAGTTTCTGCTTGAGATTATGACTGTGGCGCTGTATGCTTACTTTCGTGTCG
ACTTGCTCTTTCATATCCCCAATGGTGCGAGCAAGCCGGGAGACTACTCTGGCAATGTCGACTTGAATGCCAAGC
CGCAGCTGTGGACGACGCGTGATATCGAGGGCGCAATTGACAAGCTTGGTGTGGGCTATGAGATTTTGACGTCAA
AGCAGAGGAATGGGCAAGGACCAGTCTTGGCGTTGCTGTATCCGGCTTGTGCTGGGCAGTATGGCGTCGAGGAAA
AGACGTCGGTTATAGTGTCCGAGTATCCGCGGAATATGTCGGACAGGAGTCTGCACAAGGGGCTGCCGCCAATTC
GGCCTGAGCGGGCGCCAAGAGGGTCTCTTTACATGACTGAGCGACGATGTTCTGAGGAGCTGTATCCAATGTCGT
TTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail