Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1588
Gene name
LocationContig_143:704..1836
Strand+
Gene length (bp)1132
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00975 Thioesterase Thioesterase domain 5.6E-18 106 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 12 345 6.0E-52
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 6 347 3.0E-50
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 10 341 9.0E-47
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 40 202 2.0E-09
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 29 203 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 12 345 6.0E-52
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 6 347 3.0E-50
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 10 341 9.0E-47
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 40 202 2.0E-09
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 29 203 3.0E-08
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 103 202 1.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 31 202 2.0E-07
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 139 207 4.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 107 210 1.0E-06
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 107 203 1.0E-06
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 29 203 2.0E-06
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 106 203 9.0E-06
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 106 203 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7757
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1123
Ophiocordyceps australis map64 (Brazil) OphauB2|1588 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1588
MAVTAWRGALRIIADQSGLEPGEIVEADDVEFTALGINRILAGAILAQMRGPGGEALPTDFFDRVPTVGAFRRFY
EPAPTPSPQRSLSPIAPSLVLQKSPATARYTLFLLPDGSGSAMAYAGLLPVHEDVCVVGLNSPFLRDAGEYTCIE
DFANICLREIYRRQPVGPYILGGWSAGGYYAFEVAKRLLGQGHVVDKLLLLDSPSRTVFESLPMSVVRHLAARDL
MGNWGAQEPPKWLMPHFASTVAAVARYFPTPMPQGVEMKTYIIWSRDGVLDEQGMAASGLDDGVRVSRFLLRGKE
DWGPNGWDELLSRGGAFIATTGGTHFTMVNKPHVAELSALLCDAVVGTSPQRQHIWKQAA*
Coding >OphauB2|1588
ATGGCCGTCACGGCATGGCGCGGCGCACTGCGCATCATTGCCGACCAAAGCGGCCTCGAGCCCGGCGAAATCGTC
GAGGCCGACGACGTGGAATTCACCGCCCTTGGCATCAACCGTATCCTCGCCGGCGCCATTCTCGCCCAGATGCGC
GGCCCCGGCGGCGAGGCCCTTCCCACCGACTTTTTCGACCGCGTGCCCACCGTTGGTGCCTTTCGCCGCTTCTAT
GAGCCTGCTCCTACTCCCAGCCCCCAACGCAGCCTTTCGCCCATTGCGCCATCGCTGGTGCTGCAGAAATCTCCT
GCAACTGCTCGGTATACGCTTTTTCTTCTTCCAGACGGCAGCGGGTCTGCCATGGCGTATGCGGGGCTGTTGCCT
GTGCATGAGGACGTGTGTGTGGTGGGTTTGAATTCGCCGTTTTTGCGCGATGCTGGGGAATACACCTGCATTGAG
GACTTTGCAAATATTTGTCTGCGCGAGATATATCGGCGACAACCTGTTGGGCCGTATATACTAGGTGGATGGTCG
GCGGGCGGATACTATGCCTTTGAAGTGGCCAAGCGGCTTCTTGGTCAGGGGCATGTAGTTGACAAGCTTCTTTTG
CTAGACTCGCCGAGCCGCACTGTGTTTGAGTCGCTGCCCATGTCCGTGGTGCGGCATCTGGCTGCGCGCGACTTG
ATGGGCAACTGGGGCGCGCAGGAGCCGCCAAAGTGGCTCATGCCGCACTTTGCCTCGACAGTGGCGGCCGTGGCG
AGATATTTCCCTACCCCCATGCCGCAAGGGGTGGAGATGAAGACGTACATCATCTGGAGCCGCGACGGGGTGCTG
GATGAGCAGGGCATGGCGGCGTCGGGGCTGGATGATGGAGTCAGGGTGTCGCGGTTTTTGCTTCGTGGAAAGGAG
GATTGGGGGCCGAATGGATGGGATGAGCTGCTGTCGCGAGGGGGGGCTTTTATTGCTACTACGGGGGGAACGCAT
TTCACAATGGTGAATAAGCCGCATGTGGCTGAGCTGAGTGCCCTCTTGTGCGACGCCGTGGTAGGGACTAGTCCC
CAGCGCCAGCACATTTGGAAGCAAGCGGCATAG
Transcript >OphauB2|1588
ATGGCCGTCACGGCATGGCGCGGCGCACTGCGCATCATTGCCGACCAAAGCGGCCTCGAGCCCGGCGAAATCGTC
GAGGCCGACGACGTGGAATTCACCGCCCTTGGCATCAACCGTATCCTCGCCGGCGCCATTCTCGCCCAGATGCGC
GGCCCCGGCGGCGAGGCCCTTCCCACCGACTTTTTCGACCGCGTGCCCACCGTTGGTGCCTTTCGCCGCTTCTAT
GAGCCTGCTCCTACTCCCAGCCCCCAACGCAGCCTTTCGCCCATTGCGCCATCGCTGGTGCTGCAGAAATCTCCT
GCAACTGCTCGGTATACGCTTTTTCTTCTTCCAGACGGCAGCGGGTCTGCCATGGCGTATGCGGGGCTGTTGCCT
GTGCATGAGGACGTGTGTGTGGTGGGTTTGAATTCGCCGTTTTTGCGCGATGCTGGGGAATACACCTGCATTGAG
GACTTTGCAAATATTTGTCTGCGCGAGATATATCGGCGACAACCTGTTGGGCCGTATATACTAGGTGGATGGTCG
GCGGGCGGATACTATGCCTTTGAAGTGGCCAAGCGGCTTCTTGGTCAGGGGCATGTAGTTGACAAGCTTCTTTTG
CTAGACTCGCCGAGCCGCACTGTGTTTGAGTCGCTGCCCATGTCCGTGGTGCGGCATCTGGCTGCGCGCGACTTG
ATGGGCAACTGGGGCGCGCAGGAGCCGCCAAAGTGGCTCATGCCGCACTTTGCCTCGACAGTGGCGGCCGTGGCG
AGATATTTCCCTACCCCCATGCCGCAAGGGGTGGAGATGAAGACGTACATCATCTGGAGCCGCGACGGGGTGCTG
GATGAGCAGGGCATGGCGGCGTCGGGGCTGGATGATGGAGTCAGGGTGTCGCGGTTTTTGCTTCGTGGAAAGGAG
GATTGGGGGCCGAATGGATGGGATGAGCTGCTGTCGCGAGGGGGGGCTTTTATTGCTACTACGGGGGGAACGCAT
TTCACAATGGTGAATAAGCCGCATGTGGCTGAGCTGAGTGCCCTCTTGTGCGACGCCGTGGTAGGGACTAGTCCC
CAGCGCCAGCACATTTGGAAGCAAGCGGCATAG
Gene >OphauB2|1588
ATGGCCGTCACGGCATGGCGCGGCGCACTGCGCATCATTGCCGACCAAAGCGGCCTCGAGCCCGGCGAAATCGTC
GAGGCCGACGACGTGGAATTCACCGCCCTTGGCATCAACCGTATCCTCGCCGGCGCCATTCTCGCCCAGATGCGC
GGCCCCGGCGGCGAGGCCCTTCCCACCGACTTTTTCGACCGCGTGCCCACCGTTGGTGCCTTTCGCCGCTTCTAT
GAGCCTGCTCCTACTCCCAGCCCCCAACGCAGCCTTTCGCCCATTGCGCCATCGCTGGTGCTGCAGAAATCTCCT
GCAACTGCTCGGTATACGCTTTTTCTTCTTCCAGACGGCAGCGGGTCTGCCATGGCGTATGCGGGGCTGTTGCCT
GTGCATGAGGACGTGTGTGTGGTGGGTTTGAATTCGCCGTTTTTGCGCGATGCTGGGGAATACACCTGCATTGAG
GACTTTGCAAATATTTGTCTGCGCGAGATATATCGGCGACAACCTGTTGGGCCGTATATACTAGGTGGATGGTCG
GCGGGCGGATACTATGCCTTTGAAGTGGCCAAGCGGCTTCTTGGTCAGGGGCATGTAGTTGACAAGCTTCTTTTG
CTAGACTCGCCGAGCCGCACTGTGTTTGAGTCGCTGCCCATGTCCGTGGTGCGGCATCTGGCTGCGCGCGACTTG
ATGGGCAACTGGGGCGCGCAGGAGCCGCCAAAGTGGCTCATGCCGCACTTTGCCTCGACAGTGGCGGCCGTGGCG
AGATATTTCCCTACCCCCATGCCGCAAGGGGTGGAGATGAAGACGTACATCATCTGGAGCCGCGACGGGGTGCTG
GATGAGCAGGGCATGGCGGCGTCGGGGCTGGATGATGGAGTCAGGGTGTCGCGGTTTTTGCTTCGTGGAAAGGAG
GATTGGGGGCCGAATGGATGGGATGAGCTGCTGTCGCGAGGGGGGGCTTTTATTGCTACTACGGGGGGAACGCAT
TTCACAATGGTGAATAAGCCGCATGTAAGTCTTGCTTTTTGCTTTTGTTTGCGGGTTTGGCTAACAAGACTAGGT
GGCTGAGCTGAGTGCCCTCTTGTGCGACGCCGTGGTAGGGACTAGTCCCCAGCGCCAGCACATTTGGAAGCAAGC
GGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail