Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1585
Gene name
LocationContig_142:40824..42430
Strand+
Gene length (bp)1606
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02214 BTB_2 BTB/POZ domain 9.7E-05 24 117

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03900|YD132_YEAST Uncharacterized protein YDR132C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR132C PE=1 SV=1 4 326 6.0E-49
sp|Q12259|YL108_YEAST BTB/POZ domain-containing protein YLR108C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR108C PE=1 SV=1 7 317 2.0E-36
sp|A3KMV1|SHKB1_BOVIN SH3KBP1-binding protein 1 OS=Bos taurus GN=SHKBP1 PE=2 SV=1 12 174 8.0E-07
sp|Q8TBC3|SHKB1_HUMAN SH3KBP1-binding protein 1 OS=Homo sapiens GN=SHKBP1 PE=1 SV=2 12 174 8.0E-07

GO

GO Term Description Terminal node
GO:0051260 protein homooligomerization Yes
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0043933 protein-containing complex organization No
GO:0051259 protein complex oligomerization No
GO:0022607 cellular component assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1585
MRQPSEKTLSKIPEILPHGRVFPIQIGGEMFKLSGASLSSDAPSYFSQYFLCQIKTAEENGEEPCASVRTLYIDR
DPATFADIALHLQGYHVTPRDGTHFVRLFADAQFYSLPKLMSQLFEESIFISIGHREFQIPRDLLTSPTNSPNYF
SLGFAAFFSRPDNMFPGLDREGLIRPPAIRPPSVPNRSADTFAALLRLLRGYPVDIRDEAHRQELLRDARYFHFK
GLEQQLIPHSISYNLMRQRDEIVLRLENVQKSGVSIARDGEAEAQPQPQLQYQQQPQHVFAAWVNYARPYVDDRP
AELVLEIGGETTRVHFGPDGPRAEFFRDTKARVAKLLEVIATKLSLPPTTQPLGLLMATGGASSQPATPGNTPLS
DDLVRVALGPDAAVVVDGKPLSTCQVDVDAAEVVADASQGLRKRRRTDDGAADETWIVKTGQWRLRLQSSKSGKS
SVECVLVAVRIDAVSSELGRNMVRGFLAA*
Coding >OphauB2|1585
ATGAGGCAGCCTTCGGAAAAGACACTGTCAAAGATTCCCGAAATTCTTCCCCACGGCCGCGTATTTCCAATTCAG
ATTGGCGGCGAGATGTTTAAGCTCTCGGGAGCGTCACTGAGCTCCGATGCTCCCTCATACTTTTCTCAGTATTTT
CTCTGCCAAATCAAGACGGCCGAGGAAAACGGCGAGGAGCCGTGCGCCTCGGTTCGAACTCTGTACATTGATCGC
GATCCAGCCACCTTTGCCGACATTGCTCTGCACCTCCAAGGCTACCACGTCACGCCCCGCGATGGCACGCACTTT
GTGCGTCTTTTTGCCGATGCCCAGTTTTACAGCCTTCCCAAGCTCATGTCACAGCTCTTTGAGGAGAGCATCTTC
ATCTCGATTGGCCACCGCGAATTTCAGATTCCTCGCGATCTTTTGACCAGCCCCACCAACTCGCCAAACTACTTT
TCCCTTGGCTTTGCTGCCTTCTTCTCACGTCCCGACAACATGTTTCCTGGACTCGACCGCGAAGGCCTGATTCGT
CCTCCCGCCATTCGCCCGCCCTCAGTTCCCAATAGATCTGCCGATACGTTTGCCGCCCTGTTGCGCCTATTGCGC
GGGTACCCTGTTGATATACGGGATGAGGCCCATCGCCAAGAGCTGCTGCGCGACGCCAGATACTTTCACTTCAAG
GGCCTTGAGCAACAGCTCATTCCCCACAGCATTAGCTATAACCTGATGCGCCAGCGCGACGAGATTGTGCTTCGT
CTCGAAAACGTGCAAAAGAGCGGTGTCAGCATTGCGCGTGACGGCGAGGCTGAGGCTCAGCCCCAGCCCCAGCTT
CAGTACCAACAGCAGCCGCAACACGTCTTTGCCGCCTGGGTCAACTATGCGCGGCCATATGTCGACGATCGGCCA
GCAGAACTAGTGCTCGAAATAGGCGGGGAGACGACACGAGTTCACTTTGGGCCCGACGGGCCTCGGGCCGAGTTT
TTTCGCGACACAAAAGCCCGCGTTGCCAAGCTGCTCGAAGTAATAGCCACCAAGCTGAGCTTGCCGCCCACGACA
CAGCCTCTGGGTCTGCTCATGGCTACTGGCGGCGCCAGCTCCCAGCCTGCTACACCGGGAAACACGCCCTTGAGC
GATGACCTGGTCCGTGTTGCATTGGGCCCAGATGCCGCCGTCGTGGTTGATGGAAAGCCCCTGTCGACATGCCAA
GTTGACGTGGATGCCGCCGAAGTGGTTGCCGATGCGAGTCAAGGCTTGCGCAAGCGCCGGCGAACCGACGATGGC
GCCGCTGACGAGACGTGGATCGTCAAGACGGGCCAGTGGCGCCTGCGCCTTCAGTCTAGCAAAAGTGGCAAAAGC
TCTGTCGAGTGCGTCCTCGTTGCTGTTCGCATAGATGCCGTCAGCTCCGAGCTGGGCCGCAACATGGTCAGGGGC
TTCCTCGCTGCCTGA
Transcript >OphauB2|1585
ATGAGGCAGCCTTCGGAAAAGACACTGTCAAAGATTCCCGAAATTCTTCCCCACGGCCGCGTATTTCCAATTCAG
ATTGGCGGCGAGATGTTTAAGCTCTCGGGAGCGTCACTGAGCTCCGATGCTCCCTCATACTTTTCTCAGTATTTT
CTCTGCCAAATCAAGACGGCCGAGGAAAACGGCGAGGAGCCGTGCGCCTCGGTTCGAACTCTGTACATTGATCGC
GATCCAGCCACCTTTGCCGACATTGCTCTGCACCTCCAAGGCTACCACGTCACGCCCCGCGATGGCACGCACTTT
GTGCGTCTTTTTGCCGATGCCCAGTTTTACAGCCTTCCCAAGCTCATGTCACAGCTCTTTGAGGAGAGCATCTTC
ATCTCGATTGGCCACCGCGAATTTCAGATTCCTCGCGATCTTTTGACCAGCCCCACCAACTCGCCAAACTACTTT
TCCCTTGGCTTTGCTGCCTTCTTCTCACGTCCCGACAACATGTTTCCTGGACTCGACCGCGAAGGCCTGATTCGT
CCTCCCGCCATTCGCCCGCCCTCAGTTCCCAATAGATCTGCCGATACGTTTGCCGCCCTGTTGCGCCTATTGCGC
GGGTACCCTGTTGATATACGGGATGAGGCCCATCGCCAAGAGCTGCTGCGCGACGCCAGATACTTTCACTTCAAG
GGCCTTGAGCAACAGCTCATTCCCCACAGCATTAGCTATAACCTGATGCGCCAGCGCGACGAGATTGTGCTTCGT
CTCGAAAACGTGCAAAAGAGCGGTGTCAGCATTGCGCGTGACGGCGAGGCTGAGGCTCAGCCCCAGCCCCAGCTT
CAGTACCAACAGCAGCCGCAACACGTCTTTGCCGCCTGGGTCAACTATGCGCGGCCATATGTCGACGATCGGCCA
GCAGAACTAGTGCTCGAAATAGGCGGGGAGACGACACGAGTTCACTTTGGGCCCGACGGGCCTCGGGCCGAGTTT
TTTCGCGACACAAAAGCCCGCGTTGCCAAGCTGCTCGAAGTAATAGCCACCAAGCTGAGCTTGCCGCCCACGACA
CAGCCTCTGGGTCTGCTCATGGCTACTGGCGGCGCCAGCTCCCAGCCTGCTACACCGGGAAACACGCCCTTGAGC
GATGACCTGGTCCGTGTTGCATTGGGCCCAGATGCCGCCGTCGTGGTTGATGGAAAGCCCCTGTCGACATGCCAA
GTTGACGTGGATGCCGCCGAAGTGGTTGCCGATGCGAGTCAAGGCTTGCGCAAGCGCCGGCGAACCGACGATGGC
GCCGCTGACGAGACGTGGATCGTCAAGACGGGCCAGTGGCGCCTGCGCCTTCAGTCTAGCAAAAGTGGCAAAAGC
TCTGTCGAGTGCGTCCTCGTTGCTGTTCGCATAGATGCCGTCAGCTCCGAGCTGGGCCGCAACATGGTCAGGGGC
TTCCTCGCTGCCTGA
Gene >OphauB2|1585
ATGAGGCAGCCTTCGGAAAAGACACTGTCAAAGATTCCCGAAATTCTTCCCCACGGCCGCGTATTTCCAATTCAG
ATTGGCGGCGAGATGTTTAAGCTCTCGGGAGCGTCACTGAGCTCCGATGGTTGGTGACGGCGCTTCTTTGCCTTT
GCCTCGTCTCTTGTTGCTTCCCGTCTTGCCTCGGGCGTCTCTTTGCGCCGCTGACTGGCCCTCTCTCCAGCTCCC
TCATACTTTTCTCAGTATTTTCTCTGCCAAATCAAGACGGCCGAGGAAAACGGCGAGGAGCCGTGCGCCTCGGTT
CGAACTCTGTACATTGATCGCGATCCAGCCACCTTTGCCGACATTGCTCTGCACCTCCAAGGCTACCACGTCACG
CCCCGCGATGGCACGCACTTTGTGCGTCTTTTTGCCGATGCCCAGTTTTACAGCCGTATAGCAGCTCCCACGCCG
GCCTCAAGAGACGTCAAGCCAGAATGGGTTGCGCTGACCAGGTGGCCTAGTTCCCAAGCTCATGTCACAGCTCTT
TGAGGAGAGCATCTTCATCTCGATTGGCCACCGCGAATTTCAGATTCCTCGCGATCTTTTGACCAGCCCCACCAA
CTCGCCAAACTACTTTTCCCTTGGCTTTGCTGCCTTCTTCTCACGTCCCGACAACATGTTTCCTGGACTCGACCG
CGAAGGCCTGATTCGTCCTCCCGCCATTCGCCCGCCCTCAGTTCCCAATAGATCTGCCGATACGTTTGCCGCCCT
GTTGCGCCTATTGCGCGGGTACCCTGTTGATATACGGGATGAGGCCCATCGCCAAGAGCTGCTGCGCGACGCCAG
ATACTTTCACTTCAAGGGCCTTGAGCAACAGCTCATTCCCCACAGCATTAGCTATAACCTGATGCGCCAGCGCGA
CGAGATTGTGCTTCGTCTCGAAAACGTGCAAAAGAGCGGTGTCAGCATTGCGCGTGACGGCGAGGCTGAGGCTCA
GCCCCAGCCCCAGCTTCAGTACCAACAGCAGCCGCAACACGTCTTTGCCGCCTGGGTCAACTATGCGCGGCCATA
TGTCGACGATCGGCCAGCAGAACTAGTGCTCGAAATAGGCGGGGAGACGACACGAGTTCACTTTGGGCCCGACGG
GCCTCGGGCCGAGTTTTTTCGCGACACAAAAGCCCGCGTTGCCAAGCTGCTCGAAGTAATAGCCACCAAGCTGAG
CTTGCCGCCCACGACACAGCCTCTGGGTCTGCTCATGGCTACTGGCGGCGCCAGCTCCCAGCCTGCTACACCGGG
AAACACGCCCTTGAGCGATGACCTGGTCCGTGTTGCATTGGGCCCAGATGCCGCCGTCGTGGTTGATGGAAAGCC
CCTGTCGACATGCCAAGTTGACGTGGATGCCGCCGAAGTGGTTGCCGATGCGAGTCAAGGCTTGCGCAAGCGCCG
GCGAACCGACGATGGCGCCGCTGACGAGACGTGGATCGTCAAGACGGGCCAGTGGCGCCTGCGCCTTCAGTCTAG
CAAAAGTGGCAAAAGCTCTGTCGAGTGCGTCCTCGTTGCTGTTCGCATAGATGCCGTCAGCTCCGAGCTGGGCCG
CAACATGGTCAGGGGCTTCCTCGCTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail