Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1582
Gene name
LocationContig_142:31079..33112
Strand-
Gene length (bp)2033
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00854 PTR2 POT family 1.9E-87 157 543

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 35 583 7.0E-167
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 63 594 1.0E-165
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 55 575 3.0E-72
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 51 562 5.0E-36
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 80 458 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32901|PTR2_YEAST Peptide transporter PTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTR2 PE=1 SV=2 35 583 7.0E-167
sp|Q9P380|PTR2_SCHPO Probable peptide transporter ptr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr2 PE=1 SV=1 63 594 1.0E-165
sp|P46030|PTR2_CANAX Peptide transporter PTR2 OS=Candida albicans GN=PTR2 PE=3 SV=1 55 575 3.0E-72
sp|Q68F72|S15A4_XENLA Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1 51 562 5.0E-36
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 80 458 3.0E-35
sp|Q9JIP7|S15A1_MOUSE Solute carrier family 15 member 1 OS=Mus musculus GN=Slc15a1 PE=1 SV=2 80 485 4.0E-35
sp|P51574|S15A1_RAT Solute carrier family 15 member 1 OS=Rattus norvegicus GN=Slc15a1 PE=2 SV=1 80 485 5.0E-34
sp|P46059|S15A1_HUMAN Solute carrier family 15 member 1 OS=Homo sapiens GN=SLC15A1 PE=2 SV=1 80 476 1.0E-33
sp|A6QQL0|S15A4_BOVIN Solute carrier family 15 member 4 OS=Bos taurus GN=SLC15A4 PE=2 SV=2 86 520 1.0E-32
sp|O09014|S15A4_RAT Solute carrier family 15 member 4 OS=Rattus norvegicus GN=Slc15a4 PE=1 SV=1 86 549 3.0E-32
sp|Q9M390|PTR1_ARATH Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana GN=NPF8.1 PE=1 SV=1 90 540 4.0E-32
sp|Q8N697|S15A4_HUMAN Solute carrier family 15 member 4 OS=Homo sapiens GN=SLC15A4 PE=2 SV=1 86 520 5.0E-32
sp|P46032|PTR2_ARATH Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana GN=NPF8.3 PE=1 SV=1 90 538 1.0E-31
sp|Q84WG0|PTR26_ARATH Protein NRT1/ PTR FAMILY 8.4 OS=Arabidopsis thaliana GN=NPF8.4 PE=2 SV=2 72 538 2.0E-31
sp|Q91W98|S15A4_MOUSE Solute carrier family 15 member 4 OS=Mus musculus GN=Slc15a4 PE=1 SV=1 196 549 2.0E-31
sp|P36836|S15A1_RABIT Solute carrier family 15 member 1 OS=Oryctolagus cuniculus GN=SLC15A1 PE=2 SV=1 80 458 7.0E-31
sp|Q9ES07|S15A2_MOUSE Solute carrier family 15 member 2 OS=Mus musculus GN=Slc15a2 PE=1 SV=1 76 448 3.0E-30
sp|P91679|PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster GN=yin PE=1 SV=2 80 426 6.0E-30
sp|Q63424|S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus GN=Slc15a2 PE=1 SV=1 76 448 2.0E-29
sp|Q16348|S15A2_HUMAN Solute carrier family 15 member 2 OS=Homo sapiens GN=SLC15A2 PE=2 SV=2 76 433 8.0E-28
sp|P46029|S15A2_RABIT Solute carrier family 15 member 2 OS=Oryctolagus cuniculus GN=SLC15A2 PE=2 SV=1 69 433 1.0E-27
sp|Q93Z20|PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5 OS=Arabidopsis thaliana GN=NPF8.5 PE=2 SV=1 90 538 5.0E-27
sp|Q9LFB8|PTR5_ARATH Protein NRT1/ PTR FAMILY 8.2 OS=Arabidopsis thaliana GN=NPF8.2 PE=2 SV=1 90 538 4.0E-26
sp|Q21219|PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans GN=pept-1 PE=2 SV=2 80 463 1.0E-23
sp|O01840|PEPT3_CAEEL Peptide transporter 3 OS=Caenorhabditis elegans GN=pept-3 PE=1 SV=1 68 448 6.0E-22
sp|Q17758|PEPT2_CAEEL Peptide transporter family 2 OS=Caenorhabditis elegans GN=pept-2 PE=1 SV=2 54 456 3.0E-21
sp|Q9LQL2|PTR14_ARATH Protein NRT1/ PTR FAMILY 7.3 OS=Arabidopsis thaliana GN=NPF7.3 PE=1 SV=2 123 540 2.0E-20
sp|Q9LVE0|PTR33_ARATH Protein NRT1/ PTR FAMILY 6.4 OS=Arabidopsis thaliana GN=NPF6.4 PE=1 SV=1 150 572 3.0E-19
sp|Q56XQ6|PTR15_ARATH Protein NRT1/ PTR FAMILY 4.4 OS=Arabidopsis thaliana GN=NPF4.4 PE=2 SV=1 151 537 5.0E-19
sp|Q924V4|S15A3_RAT Solute carrier family 15 member 3 OS=Rattus norvegicus GN=Slc15a3 PE=2 SV=1 243 548 2.0E-18
sp|Q9FNL7|PTR3_ARATH Protein NRT1/ PTR FAMILY 5.2 OS=Arabidopsis thaliana GN=NPF5.2 PE=2 SV=1 56 541 8.0E-18
sp|Q05085|PTR7_ARATH Protein NRT1/ PTR FAMILY 6.3 OS=Arabidopsis thaliana GN=NPF6.3 PE=1 SV=1 82 538 3.0E-17
sp|Q9C7U1|PTR25_ARATH Protein NRT1/ PTR FAMILY 5.12 OS=Arabidopsis thaliana GN=NPF5.12 PE=2 SV=1 90 538 3.0E-17
sp|Q8GXN2|PTR47_ARATH Protein NRT1/ PTR FAMILY 7.2 OS=Arabidopsis thaliana GN=NPF7.2 PE=2 SV=2 123 540 2.0E-16
sp|Q8VZE2|PTR22_ARATH Protein NRT1/ PTR FAMILY 5.14 OS=Arabidopsis thaliana GN=NPF5.14 PE=2 SV=2 73 522 3.0E-16
sp|Q0WSZ6|PTR23_ARATH Protein NRT1/ PTR FAMILY 5.13 OS=Arabidopsis thaliana GN=NPF5.13 PE=2 SV=2 82 522 3.0E-16
sp|Q8BPX9|S15A3_MOUSE Solute carrier family 15 member 3 OS=Mus musculus GN=Slc15a3 PE=2 SV=1 243 548 6.0E-16
sp|Q3E9B5|PTR51_ARATH Protein NRT1/ PTR FAMILY 7.1 OS=Arabidopsis thaliana GN=NPF7.1 PE=2 SV=1 123 540 1.0E-15
sp|Q8IY34|S15A3_HUMAN Solute carrier family 15 member 3 OS=Homo sapiens GN=SLC15A3 PE=2 SV=2 86 542 1.0E-15
sp|Q9LFR1|PTR50_ARATH Protein NRT1/ PTR FAMILY 5.8 OS=Arabidopsis thaliana GN=NPF5.8 PE=2 SV=1 79 538 2.0E-15
sp|Q9M1I2|PTR46_ARATH Protein NRT1/ PTR FAMILY 5.4 OS=Arabidopsis thaliana GN=NPF5.4 PE=2 SV=1 82 583 2.0E-15
sp|Q9SZY4|PTR27_ARATH Protein NRT1/ PTR FAMILY 6.2 OS=Arabidopsis thaliana GN=NPF6.2 PE=1 SV=1 150 538 3.0E-15
sp|Q9FNL8|PTR4_ARATH Protein NRT1/ PTR FAMILY 5.3 OS=Arabidopsis thaliana GN=NPF5.3 PE=2 SV=1 56 537 5.0E-15
sp|Q8H157|PTR19_ARATH Protein NRT1/ PTR FAMILY 4.6 OS=Arabidopsis thaliana GN=NPF4.6 PE=1 SV=1 150 538 1.0E-14
sp|P0CI03|PTR28_ARATH Protein NRT1/ PTR FAMILY 5.6 OS=Arabidopsis thaliana GN=NPF5.6 PE=2 SV=1 82 541 2.0E-14
sp|Q8RX67|PTR24_ARATH Protein NRT1/ PTR FAMILY 5.11 OS=Arabidopsis thaliana GN=NPF5.11 PE=2 SV=1 82 566 2.0E-14
sp|Q93VV5|PTR16_ARATH Protein NRT1/ PTR FAMILY 4.3 OS=Arabidopsis thaliana GN=NPF4.3 PE=2 SV=1 140 538 9.0E-14
sp|Q9FM20|PTR54_ARATH Protein NRT1/ PTR FAMILY 4.7 OS=Arabidopsis thaliana GN=NPF4.7 PE=2 SV=2 144 537 1.0E-13
sp|Q9SK99|PTR11_ARATH Protein NRT1/ PTR FAMILY 5.15 OS=Arabidopsis thaliana GN=NPF5.15 PE=2 SV=1 82 538 9.0E-13
sp|Q8LPL2|PTR32_ARATH Protein NRT1/ PTR FAMILY 1.1 OS=Arabidopsis thaliana GN=NPF1.1 PE=1 SV=2 59 541 1.0E-12
sp|Q9M331|PTR45_ARATH Protein NRT1/ PTR FAMILY 5.7 OS=Arabidopsis thaliana GN=NPF5.7 PE=2 SV=2 82 539 2.0E-12
sp|Q8VYE4|PTR12_ARATH Protein NRT1/ PTR FAMILY 4.5 OS=Arabidopsis thaliana GN=NPF4.5 PE=2 SV=1 151 538 3.0E-12
sp|Q9M817|PTR6_ARATH Protein NRT1/ PTR FAMILY 1.2 OS=Arabidopsis thaliana GN=NPF1.2 PE=1 SV=1 64 541 2.0E-11
sp|Q9SRI2|PTR31_ARATH Protein NRT1/ PTR FAMILY 5.9 OS=Arabidopsis thaliana GN=NPF5.9 PE=2 SV=1 72 575 3.0E-11
sp|D3V3D1|DTPB_XENBS Dipeptide and tripeptide permease B OS=Xenorhabdus bovienii (strain SS-2004) GN=dtpB PE=3 SV=1 80 542 2.0E-10
sp|Q9SK96|PTR10_ARATH Protein NRT1/ PTR FAMILY 5.16 OS=Arabidopsis thaliana GN=NPF5.16 PE=2 SV=1 82 538 4.0E-10
sp|Q9LSE8|PTR35_ARATH Protein NRT1/ PTR FAMILY 4.2 OS=Arabidopsis thaliana GN=NPF4.2 PE=2 SV=1 140 539 2.0E-09
sp|Q0WP01|PTR9_ARATH Protein NRT1/ PTR FAMILY 5.10 OS=Arabidopsis thaliana GN=NPF5.10 PE=2 SV=1 347 538 2.0E-09
sp|Q9JIP7|S15A1_MOUSE Solute carrier family 15 member 1 OS=Mus musculus GN=Slc15a1 PE=1 SV=2 475 583 3.0E-09
sp|Q9M9V7|PTR8_ARATH Protein NRT1/ PTR FAMILY 2.9 OS=Arabidopsis thaliana GN=NPF2.9 PE=1 SV=1 144 541 5.0E-09
sp|P51574|S15A1_RAT Solute carrier family 15 member 1 OS=Rattus norvegicus GN=Slc15a1 PE=2 SV=1 475 583 2.0E-08
sp|Q63424|S15A2_RAT Solute carrier family 15 member 2 OS=Rattus norvegicus GN=Slc15a2 PE=1 SV=1 476 594 2.0E-08
sp|O01840|PEPT3_CAEEL Peptide transporter 3 OS=Caenorhabditis elegans GN=pept-3 PE=1 SV=1 465 537 3.0E-08
sp|Q8WMX5|S15A1_CANLF Solute carrier family 15 member 1 OS=Canis lupus familiaris GN=SLC15A1 PE=2 SV=2 464 583 3.0E-08
sp|Q17758|PEPT2_CAEEL Peptide transporter family 2 OS=Caenorhabditis elegans GN=pept-2 PE=1 SV=2 476 531 3.0E-08
sp|Q9ES07|S15A2_MOUSE Solute carrier family 15 member 2 OS=Mus musculus GN=Slc15a2 PE=1 SV=1 476 569 7.0E-08
sp|P46059|S15A1_HUMAN Solute carrier family 15 member 1 OS=Homo sapiens GN=SLC15A1 PE=2 SV=1 464 583 1.0E-07
sp|P36836|S15A1_RABIT Solute carrier family 15 member 1 OS=Oryctolagus cuniculus GN=SLC15A1 PE=2 SV=1 464 583 1.0E-07
sp|Q8GFA2|DTPB_PHOLU Dipeptide and tripeptide permease B OS=Photorhabdus luminescens GN=dtpB PE=3 SV=1 80 543 1.0E-07
sp|P77304|DTPA_ECOLI Dipeptide and tripeptide permease A OS=Escherichia coli (strain K12) GN=dtpA PE=1 SV=1 62 293 1.0E-07
sp|Q8X651|DTPA_ECO57 Dipeptide and tripeptide permease A OS=Escherichia coli O157:H7 GN=dtpA PE=3 SV=1 62 293 1.0E-07
sp|Q8FH91|DTPA_ECOL6 Dipeptide and tripeptide permease A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dtpA PE=3 SV=1 62 293 1.0E-07
sp|Q8ZPM6|DTPA_SALTY Dipeptide and tripeptide permease A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dtpA PE=2 SV=1 80 526 2.0E-07
sp|P46029|S15A2_RABIT Solute carrier family 15 member 2 OS=Oryctolagus cuniculus GN=SLC15A2 PE=2 SV=1 476 569 2.0E-07
sp|B6VMU9|DTPB_PHOAA Dipeptide and tripeptide permease B OS=Photorhabdus asymbiotica subsp. asymbiotica (strain ATCC 43949 / 3105-77) GN=dtpB PE=3 SV=1 80 526 2.0E-07
sp|A1JRI8|DTPB_YERE8 Dipeptide and tripeptide permease B OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dtpB PE=3 SV=1 80 526 3.0E-07
sp|Q21219|PEPT1_CAEEL Peptide transporter family 1 OS=Caenorhabditis elegans GN=pept-1 PE=2 SV=2 476 531 3.0E-07
sp|Q8Z6Q5|DTPA_SALTI Dipeptide and tripeptide permease A OS=Salmonella typhi GN=dtpA PE=3 SV=1 80 526 4.0E-07
sp|P36837|DTPB_ECOLI Dipeptide and tripeptide permease B OS=Escherichia coli (strain K12) GN=dtpB PE=1 SV=2 80 526 6.0E-07
sp|P91679|PEPT1_DROME Peptide transporter family 1 OS=Drosophila melanogaster GN=yin PE=1 SV=2 476 580 7.0E-07
sp|A0KMY1|DTPB_AERHH Dipeptide and tripeptide permease B OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dtpB PE=3 SV=1 80 543 7.0E-07
sp|Q16348|S15A2_HUMAN Solute carrier family 15 member 2 OS=Homo sapiens GN=SLC15A2 PE=2 SV=2 476 594 9.0E-07
sp|D2TBH1|DTPA_ERWP6 Dipeptide and tripeptide permease A OS=Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96) GN=dtpA PE=3 SV=1 80 543 9.0E-07
sp|Q7NRM5|DTPA_CHRVO Dipeptide and tripeptide permease A OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dtpA PE=3 SV=1 80 293 1.0E-06
sp|B4EY98|DTPA_PROMH Dipeptide and tripeptide permease A OS=Proteus mirabilis (strain HI4320) GN=dtpA PE=3 SV=1 61 293 1.0E-06
sp|Q8ZLD6|DTPB_SALTY Dipeptide and tripeptide permease B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dtpB PE=3 SV=1 80 526 2.0E-06
sp|Q0WP01|PTR9_ARATH Protein NRT1/ PTR FAMILY 5.10 OS=Arabidopsis thaliana GN=NPF5.10 PE=2 SV=1 50 221 3.0E-06
sp|B5XWP3|DTPA_KLEP3 Dipeptide and tripeptide permease A OS=Klebsiella pneumoniae (strain 342) GN=dtpA PE=3 SV=1 80 543 3.0E-06
sp|C9Y3M8|DTPA_SICTZ Dipeptide and tripeptide permease A OS=Siccibacter turicensis (strain DSM 18703 / LMG 23827 / z3032) GN=dtpA PE=3 SV=2 80 289 3.0E-06
sp|Q32AW5|DTPB_SHIDS Dipeptide and tripeptide permease B OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dtpB PE=3 SV=2 80 526 3.0E-06
sp|Q9M1E1|PTR38_ARATH Protein NRT1/ PTR FAMILY 2.6 OS=Arabidopsis thaliana GN=NPF2.6 PE=2 SV=1 127 520 3.0E-06
sp|D0ZGL2|DTPB_EDWTE Dipeptide and tripeptide permease B OS=Edwardsiella tarda (strain EIB202) GN=dtpB PE=3 SV=1 80 526 4.0E-06
sp|A8AH15|DTPA_CITK8 Dipeptide and tripeptide permease A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dtpA PE=3 SV=2 80 293 6.0E-06
sp|Q9SX20|PTR18_ARATH Protein NRT1/ PTR FAMILY 3.1 OS=Arabidopsis thaliana GN=NPF3.1 PE=2 SV=1 324 538 9.0E-06
sp|A4W9W3|DTPA_ENT38 Dipeptide and tripeptide permease A OS=Enterobacter sp. (strain 638) GN=dtpA PE=3 SV=1 62 293 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 127 149 22
2 161 183 22
3 193 215 22
4 245 267 22
5 272 291 19
6 359 381 22
7 396 418 22
8 430 452 22
9 484 506 22
10 519 540 21
11 544 566 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1582
MAMNHEDMAAELHEEFAERVPNKETDLAGGFIAHPHVKMEKTASPGYGSSGGAESDPTPDGQEPTEYEKRTLRRI
GENLPPSAFLIAFVELTERFTYYGAQGLFQNYISHDSKGSDGARGLGLGHQAATGLNLFFQWFCYVTPILGAIIS
DQFLGKYKTILIFCAIYWVGLLILWTTALPVSLEHGAGLGGYVTSLVVIGFGTGGIKSNIAPLIADQYQRRVMAI
KTEKSGERVVIDPAITYQRIYMIFYWCINVGALSLMATPFLEKYKGFWTGYLMCFAMFNVGIIILVARRKSYVIR
PPQGQIITDAFRAIGMMIMARDLDAAKPSWRQTHGKTTVVPWNDHFVEELKRALRACKVFVFYPIFWVCYGQFST
NFVTQAGQMQGHGMPNDFMQNFDPVSILVFTPILESIIYPILRRMGFELRPIARITIGFWLGALCLAYAAIVQHL
IYSAGPCYQHPGKCPAGMDGDTKLPNNVHIAVQVPAYVFIGLAEIFISVTGLEYAYTKAPPSMKSFVQSLYLFTN
AFGSALSEALVSVAVDPKYLWMYTGVACVSFITGCVFWVLFHHYDAQEEQMYDLDREQPVLTHDGVKQE*
Coding >OphauB2|1582
ATGGCCATGAACCACGAGGACATGGCTGCCGAGCTCCATGAAGAGTTCGCCGAGCGCGTCCCAAACAAAGAGACG
GACCTGGCCGGAGGCTTCATTGCGCATCCCCATGTCAAGATGGAAAAGACGGCCTCTCCAGGCTACGGCTCCTCG
GGCGGCGCCGAGTCGGACCCTACGCCCGACGGCCAGGAGCCAACCGAGTATGAGAAGCGCACGCTGCGCCGCATC
GGCGAGAATCTGCCGCCCTCTGCCTTTCTTATTGCCTTTGTCGAGCTGACGGAGCGCTTCACCTACTATGGCGCT
CAAGGCCTCTTCCAAAACTACATCAGCCACGACTCCAAGGGCTCGGATGGCGCCCGTGGCCTGGGCCTTGGCCAT
CAGGCCGCCACTGGCCTTAACCTCTTCTTTCAATGGTTTTGCTACGTGACGCCTATTCTCGGCGCCATCATATCT
GACCAGTTCCTCGGCAAATACAAGACGATTCTCATCTTCTGCGCCATCTACTGGGTCGGTCTCCTCATTCTTTGG
ACCACTGCTCTGCCCGTATCACTAGAGCATGGCGCTGGTCTTGGAGGCTACGTTACCTCGCTCGTTGTTATTGGC
TTTGGCACTGGAGGCATCAAGTCCAACATAGCACCTCTGATTGCTGATCAATACCAGAGGCGTGTCATGGCCATC
AAGACGGAAAAGAGCGGCGAGCGCGTTGTCATTGATCCTGCCATTACCTACCAGCGCATCTACATGATTTTTTAC
TGGTGCATCAATGTCGGCGCCCTCTCCCTCATGGCCACGCCCTTTTTGGAAAAGTACAAGGGCTTCTGGACTGGC
TATCTCATGTGCTTCGCCATGTTCAACGTGGGCATCATTATCCTTGTCGCACGCCGCAAGTCATATGTCATTCGT
CCGCCCCAGGGCCAGATCATTACGGATGCCTTTCGTGCCATTGGCATGATGATTATGGCGCGCGATCTTGACGCG
GCAAAACCCTCGTGGCGCCAGACTCATGGAAAGACAACGGTTGTGCCTTGGAATGACCATTTTGTCGAGGAGCTC
AAGCGTGCCCTGCGCGCCTGCAAGGTCTTTGTCTTTTATCCCATCTTTTGGGTCTGCTATGGCCAGTTCTCAACC
AACTTTGTCACACAGGCCGGCCAGATGCAAGGCCATGGCATGCCCAACGACTTTATGCAAAACTTTGATCCCGTC
TCCATCCTCGTCTTCACGCCCATTCTCGAGAGCATCATCTACCCCATTCTCCGCCGCATGGGATTCGAGCTGCGC
CCTATAGCCCGAATCACCATTGGCTTCTGGCTCGGCGCCCTGTGTCTCGCCTACGCCGCCATTGTTCAACATCTT
ATCTACTCGGCCGGCCCGTGCTACCAGCATCCCGGCAAGTGCCCTGCCGGCATGGACGGCGACACCAAGCTGCCC
AACAATGTGCACATTGCGGTCCAAGTGCCCGCCTATGTCTTCATTGGCCTCGCCGAAATCTTCATCTCCGTCACG
GGCCTCGAATACGCTTATACCAAGGCGCCGCCCTCGATGAAGTCGTTTGTCCAGTCGCTCTACCTCTTTACAAAC
GCTTTTGGCTCTGCCCTTTCCGAGGCCCTCGTCTCCGTTGCCGTCGACCCCAAATATCTGTGGATGTACACAGGC
GTAGCCTGCGTCTCCTTCATCACAGGCTGCGTCTTTTGGGTCCTCTTCCATCACTATGATGCTCAAGAAGAGCAA
ATGTATGATCTCGACCGCGAGCAGCCCGTTTTGACTCACGACGGCGTCAAGCAAGAGTAA
Transcript >OphauB2|1582
ATGGCCATGAACCACGAGGACATGGCTGCCGAGCTCCATGAAGAGTTCGCCGAGCGCGTCCCAAACAAAGAGACG
GACCTGGCCGGAGGCTTCATTGCGCATCCCCATGTCAAGATGGAAAAGACGGCCTCTCCAGGCTACGGCTCCTCG
GGCGGCGCCGAGTCGGACCCTACGCCCGACGGCCAGGAGCCAACCGAGTATGAGAAGCGCACGCTGCGCCGCATC
GGCGAGAATCTGCCGCCCTCTGCCTTTCTTATTGCCTTTGTCGAGCTGACGGAGCGCTTCACCTACTATGGCGCT
CAAGGCCTCTTCCAAAACTACATCAGCCACGACTCCAAGGGCTCGGATGGCGCCCGTGGCCTGGGCCTTGGCCAT
CAGGCCGCCACTGGCCTTAACCTCTTCTTTCAATGGTTTTGCTACGTGACGCCTATTCTCGGCGCCATCATATCT
GACCAGTTCCTCGGCAAATACAAGACGATTCTCATCTTCTGCGCCATCTACTGGGTCGGTCTCCTCATTCTTTGG
ACCACTGCTCTGCCCGTATCACTAGAGCATGGCGCTGGTCTTGGAGGCTACGTTACCTCGCTCGTTGTTATTGGC
TTTGGCACTGGAGGCATCAAGTCCAACATAGCACCTCTGATTGCTGATCAATACCAGAGGCGTGTCATGGCCATC
AAGACGGAAAAGAGCGGCGAGCGCGTTGTCATTGATCCTGCCATTACCTACCAGCGCATCTACATGATTTTTTAC
TGGTGCATCAATGTCGGCGCCCTCTCCCTCATGGCCACGCCCTTTTTGGAAAAGTACAAGGGCTTCTGGACTGGC
TATCTCATGTGCTTCGCCATGTTCAACGTGGGCATCATTATCCTTGTCGCACGCCGCAAGTCATATGTCATTCGT
CCGCCCCAGGGCCAGATCATTACGGATGCCTTTCGTGCCATTGGCATGATGATTATGGCGCGCGATCTTGACGCG
GCAAAACCCTCGTGGCGCCAGACTCATGGAAAGACAACGGTTGTGCCTTGGAATGACCATTTTGTCGAGGAGCTC
AAGCGTGCCCTGCGCGCCTGCAAGGTCTTTGTCTTTTATCCCATCTTTTGGGTCTGCTATGGCCAGTTCTCAACC
AACTTTGTCACACAGGCCGGCCAGATGCAAGGCCATGGCATGCCCAACGACTTTATGCAAAACTTTGATCCCGTC
TCCATCCTCGTCTTCACGCCCATTCTCGAGAGCATCATCTACCCCATTCTCCGCCGCATGGGATTCGAGCTGCGC
CCTATAGCCCGAATCACCATTGGCTTCTGGCTCGGCGCCCTGTGTCTCGCCTACGCCGCCATTGTTCAACATCTT
ATCTACTCGGCCGGCCCGTGCTACCAGCATCCCGGCAAGTGCCCTGCCGGCATGGACGGCGACACCAAGCTGCCC
AACAATGTGCACATTGCGGTCCAAGTGCCCGCCTATGTCTTCATTGGCCTCGCCGAAATCTTCATCTCCGTCACG
GGCCTCGAATACGCTTATACCAAGGCGCCGCCCTCGATGAAGTCGTTTGTCCAGTCGCTCTACCTCTTTACAAAC
GCTTTTGGCTCTGCCCTTTCCGAGGCCCTCGTCTCCGTTGCCGTCGACCCCAAATATCTGTGGATGTACACAGGC
GTAGCCTGCGTCTCCTTCATCACAGGCTGCGTCTTTTGGGTCCTCTTCCATCACTATGATGCTCAAGAAGAGCAA
ATGTATGATCTCGACCGCGAGCAGCCCGTTTTGACTCACGACGGCGTCAAGCAAGAGTAA
Gene >OphauB2|1582
ATGGCCATGAACCACGAGGACATGGCTGCCGAGTATGTTTCACCGCGCACCACGGACCAATTCGCTCCTGCTAAC
GGGCCGCAGGCTCCATGAAGAGTTCGCCGAGCGCGTCCCAAACAAAGAGACGGACCTGGCCGGAGGCTTCATTGC
GCATCCCCATGTCAAGATGGAAAAGACGGCCTCTCCAGGCTACGGCTCCTCGGGCGGCGCCGAGTCGGACCCTAC
GCCCGACGGCCAGGAGCCAACCGAGTATGAGAAGCGCACGCTGCGCCGCATCGGCGAGAATCTGCCGCCCTCTGC
CTTTCTTATTGCCTTTGTCGAGCTGACGGAGCGCTTCACCTACTATGGCGCTCAAGGCCTCTTCCAAAACTACAT
CAGCCACGACTCCAAGGGCTCGGATGGCGCCCGTGGCCTGGGCCTTGGCCATCAGGCCGCCACTGGCCTTAACCT
CTTCTTTCAATGGTTTTGCTACGGTGCGGTGGCTCGCGTCTTGCTTTGACGCCCTCTATGCTCTGCTAACGAGGA
GCCCTTTTTAGTGACGCCTATTCTCGGCGCCATCATATCTGACCAGTTCCTCGGCAAATACAAGACGATTCTCAT
CTTCTGCGCCATCTACTGGGTCGGTCTCCTCATTCTTTGGACCACTGCTCTGCCCGTATCACTAGAGCATGGCGC
TGGTCTTGGAGGCTACGTTACCTCGCTCGTTGTTATTGGCTTTGGCACTGGAGGTGGGATTGACCACGCCGCACT
CTTCATGGCAGTATCCCAGTCTGACAAGTCGAAACAGGCATCAAGTCCAACATAGCACCTCTGATTGCTGATCAA
TACCAGAGGCGTGTCATGGCCATCAAGACGGAAAAGAGCGGCGAGCGCGTTGTCATTGATCCTGCCATTACCTAC
CAGCGCATCTACATGATTTTTTACTGGTGCATCAATGTCGGCGCCCTCTCCCTCATGGCCACGCCCTTTTTGGAA
AAGTACAAGGGCTTCTGGACTGGCTATCTCATGTGCTTCGCCATGTTCAACGTGGGCATCATTATCCTTGTCGCA
CGCCGCAAGTCATATGTCATTCGTCCGCCCCAGGGCCAGATCATTACGGATGCCTTTCGTGCCATTGGCATGATG
ATTATGGCGCGCGATCTTGACGCGGCAAAACCCTCGTGGCGCCAGACTCATGGAAAGACAACGGTTGTGCCTTGG
AATGACCATTTTGTCGAGGAGCTCAAGCGTGCCCTGCGCGCCTGCAAGGTCTTTGTCTTTTGTACGTCTTGCCCC
GTCTCTCGCGTCTTGCCCCGTCTCTCTCGTCTTGCCTGCTGACTTGGCTCTGATTCCAAGATCCCATCTTTTGGG
TCTGCTATGGCCAGTTCTCAACCAACTTTGTCACACAGGCCGGCCAGATGCAAGGCCATGGCATGCCCAACGACT
TTATGCAAAACTTTGATCCCGTCTCCATCCTCGTCTTCACGCCCATTCTCGAGAGCATCATCTACCCCATTCTCC
GCCGCATGGGATTCGAGCTGCGCCCTATAGCCCGAATCACCATTGGCTTCTGGCTCGGCGCCCTGTGTCTCGCCT
ACGCCGCCATTGTTCAACATCTTATCTACTCGGCCGGCCCGTGCTACCAGCATCCCGGCAAGTGCCCTGCCGGCA
TGGACGGCGACACCAAGCTGCCCAACAATGTGCACATTGCGGTCCAAGTGCCCGCCTATGTCTTCATTGGCCTCG
CCGAAATCTTCATCTCCGTCACGGGCCTCGAATACGCTTATACCAAGGCGCCGCCCTCGATGAAGTCGTTTGTCC
AGTCGCTCTACCTCTTTACAAACGCTTTTGGCTCTGCCCTTTCCGAGGCCCTCGTCTCCGTTGCCGTCGACCCCA
AATATCTGTGGATGTACACAGGCGTAGCCTGCGTCTCCTTCATCACAGGCTGCGTCTTTTGGGTCCTCTTCCATC
ACTATGATGCTCAAGAAGAGCAAATGTATGATCTCGACCGCGAGCAGCCCGTTTTGACTCACGACGGCGTCAAGC
AAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail