Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1581
Gene name
LocationContig_142:28536..30525
Strand+
Gene length (bp)1989
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 2.8E-19 177 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6N5|DS1PP_SCHPO Dihydrosphingosine 1-phosphate phosphatase C823.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.11 PE=3 SV=1 97 408 5.0E-70
sp|P47013|DS1P1_YEAST Dihydrosphingosine 1-phosphate phosphatase LCB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB3 PE=1 SV=1 102 407 9.0E-54
sp|P23501|DS1P2_YEAST Dihydrosphingosine 1-phosphate phosphatase YSR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSR3 PE=3 SV=2 80 403 4.0E-50
sp|Q9M2G7|LPPD_ARATH Lipid phosphate phosphatase delta OS=Arabidopsis thaliana GN=LPPD PE=2 SV=1 98 399 1.0E-22
sp|Q55A00|SSPA_DICDI Probable sphingosine-1-phosphate phosphatase OS=Dictyostelium discoideum GN=sppA PE=3 SV=1 112 388 8.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6N5|DS1PP_SCHPO Dihydrosphingosine 1-phosphate phosphatase C823.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.11 PE=3 SV=1 97 408 5.0E-70
sp|P47013|DS1P1_YEAST Dihydrosphingosine 1-phosphate phosphatase LCB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB3 PE=1 SV=1 102 407 9.0E-54
sp|P23501|DS1P2_YEAST Dihydrosphingosine 1-phosphate phosphatase YSR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSR3 PE=3 SV=2 80 403 4.0E-50
sp|Q9M2G7|LPPD_ARATH Lipid phosphate phosphatase delta OS=Arabidopsis thaliana GN=LPPD PE=2 SV=1 98 399 1.0E-22
sp|Q55A00|SSPA_DICDI Probable sphingosine-1-phosphate phosphatase OS=Dictyostelium discoideum GN=sppA PE=3 SV=1 112 388 8.0E-18
sp|Q8IWX5|SGPP2_HUMAN Sphingosine-1-phosphate phosphatase 2 OS=Homo sapiens GN=SGPP2 PE=2 SV=1 146 408 1.0E-14
sp|Q810K3|SGPP2_MOUSE Sphingosine-1-phosphate phosphatase 2 OS=Mus musculus GN=Sgpp2 PE=2 SV=1 146 411 3.0E-14
sp|Q9BX95|SGPP1_HUMAN Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens GN=SGPP1 PE=1 SV=2 146 423 3.0E-10
sp|Q99P55|SGPP1_RAT Sphingosine-1-phosphate phosphatase 1 OS=Rattus norvegicus GN=Sgpp1 PE=1 SV=2 146 290 7.0E-09
sp|Q9JI99|SGPP1_MOUSE Sphingosine-1-phosphate phosphatase 1 OS=Mus musculus GN=Sgpp1 PE=1 SV=1 146 290 9.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 147 169 22
3 176 198 22
4 218 240 22
5 252 271 19
6 276 298 22
7 305 327 22
8 369 391 22
9 574 596 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1581
MIVSPRCRHHAVLPVLLLNVVASSFILNTICFIVTLAAALVQIPPRHPPRPALSSALRCAPPAISTMSGPGRPPS
PDAQPCNGKLVAPDADSVPEAGLRSLDHYRKALPPWRYAIRHKMLPLIRCETPYLAGLQQALRTPALDSYFAITA
NLGTHTFFMVGLPITFWCGHASFGKGLVHILALGVFGTGFVKDFLSLPRPLSPPLHRITMSGSAALEYGFPSTHS
ANAVSVAVYALLLLHSPASTLSEPTKLLLEALCYFYAASIVFGRLYCGMHGFLDVAVGSLFGVAIGWLEFTYGPC
LNQYLYSSSWLVPLLASIIIVVFVGLHPEPADDCPCFDDSVAFAGVLIGLEFGTWTYSKSSPDAAGHDSIPLGLA
LNVARIVLGVLVIFAWRETMKPTLLKLLPHLFRWMEHLGWSLPRRFFTPATEYKSVPIGSRLDTLFPAAADFPRM
VQGIRHPTTRGRSVSIGPQSAADAYETLAYRELRRRESVATGVSDDATLDDELVGSARRDRDCSGRDAQSSAVQR
HALARHDHETMANGSAASHVAEARLEEKQMFSLLVRPRVRYDVEVVTKLVIYAGIAGLATALIPLGFELVGLDAR
GS*
Coding >OphauB2|1581
ATGATCGTCTCTCCTCGTTGTCGCCATCACGCCGTCTTGCCCGTCTTGCTCCTCAATGTCGTCGCCTCGAGCTTC
ATCCTCAACACCATCTGCTTCATCGTCACTCTCGCCGCCGCCCTCGTGCAAATCCCGCCTCGCCATCCACCTCGG
CCTGCCCTGTCTTCCGCACTGCGCTGCGCGCCGCCTGCGATTTCCACCATGAGCGGCCCCGGGCGCCCGCCTTCG
CCCGATGCACAGCCTTGCAATGGCAAGCTGGTGGCTCCCGACGCCGACAGTGTCCCCGAGGCCGGTCTTAGGAGT
CTCGACCACTACAGGAAAGCGTTGCCGCCATGGCGCTATGCCATTCGCCACAAGATGCTGCCTCTGATCCGCTGC
GAGACGCCTTACCTGGCTGGCCTGCAGCAGGCGCTGCGCACACCGGCCCTCGACAGCTACTTTGCCATCACGGCC
AACTTGGGCACCCATACCTTTTTCATGGTTGGCCTGCCCATTACCTTTTGGTGCGGACACGCGTCGTTTGGAAAG
GGTCTTGTCCATATTCTGGCCCTGGGCGTCTTTGGCACGGGCTTTGTCAAGGATTTCCTGTCGCTTCCGCGTCCT
CTGTCTCCTCCTCTACACCGCATCACCATGTCGGGCTCAGCGGCCCTCGAATACGGTTTTCCTTCCACACACAGC
GCCAATGCCGTTTCAGTGGCTGTCTATGCCCTCTTGCTCCTGCACAGCCCAGCCAGTACACTATCAGAGCCCACA
AAGCTGTTGCTCGAGGCGCTCTGCTACTTTTACGCCGCATCCATTGTCTTTGGCCGTCTCTACTGCGGCATGCAC
GGCTTTCTCGACGTGGCCGTAGGCTCCTTGTTTGGTGTGGCCATTGGATGGCTAGAATTTACCTATGGTCCCTGC
CTAAACCAGTACCTGTACTCGAGCTCATGGCTTGTGCCTCTGCTCGCCAGCATCATCATTGTCGTCTTTGTCGGC
TTACATCCCGAGCCTGCTGATGACTGCCCTTGCTTTGACGACAGCGTAGCTTTTGCCGGTGTCTTGATTGGGCTC
GAGTTCGGCACATGGACGTACAGCAAAAGCTCGCCTGATGCCGCTGGCCACGACTCCATACCCCTTGGTCTGGCG
CTCAACGTGGCACGCATCGTCTTGGGCGTACTTGTCATTTTTGCCTGGCGTGAGACGATGAAGCCGACGCTGCTC
AAGCTGTTGCCCCATCTGTTTCGTTGGATGGAGCACCTTGGCTGGAGCTTGCCGAGGCGCTTCTTCACTCCAGCC
ACTGAGTACAAGTCGGTTCCTATTGGCTCGCGACTTGATACTCTGTTTCCTGCCGCTGCTGATTTCCCTCGCATG
GTGCAAGGCATCCGCCATCCCACCACTAGGGGCAGATCTGTGTCGATTGGGCCTCAGAGTGCTGCTGATGCGTAC
GAGACGCTGGCTTATCGTGAGCTCCGTCGCCGAGAGAGTGTGGCCACGGGTGTTAGTGACGATGCTACCCTTGAC
GACGAGCTCGTTGGCAGTGCTCGCAGGGATCGAGACTGCTCAGGCCGGGACGCCCAGTCAAGTGCAGTACAGAGA
CATGCTCTGGCGCGCCACGACCATGAGACAATGGCTAATGGCAGTGCTGCCAGCCACGTTGCCGAAGCGCGCCTC
GAGGAGAAGCAAATGTTTTCTCTACTTGTAAGGCCGCGAGTCAGATATGATGTCGAAGTCGTCACAAAGCTGGTC
ATTTATGCAGGCATCGCTGGTCTTGCAACGGCGCTGATTCCTCTCGGTTTTGAGCTGGTTGGCTTGGATGCTAGA
GGCTCGTAG
Transcript >OphauB2|1581
ATGATCGTCTCTCCTCGTTGTCGCCATCACGCCGTCTTGCCCGTCTTGCTCCTCAATGTCGTCGCCTCGAGCTTC
ATCCTCAACACCATCTGCTTCATCGTCACTCTCGCCGCCGCCCTCGTGCAAATCCCGCCTCGCCATCCACCTCGG
CCTGCCCTGTCTTCCGCACTGCGCTGCGCGCCGCCTGCGATTTCCACCATGAGCGGCCCCGGGCGCCCGCCTTCG
CCCGATGCACAGCCTTGCAATGGCAAGCTGGTGGCTCCCGACGCCGACAGTGTCCCCGAGGCCGGTCTTAGGAGT
CTCGACCACTACAGGAAAGCGTTGCCGCCATGGCGCTATGCCATTCGCCACAAGATGCTGCCTCTGATCCGCTGC
GAGACGCCTTACCTGGCTGGCCTGCAGCAGGCGCTGCGCACACCGGCCCTCGACAGCTACTTTGCCATCACGGCC
AACTTGGGCACCCATACCTTTTTCATGGTTGGCCTGCCCATTACCTTTTGGTGCGGACACGCGTCGTTTGGAAAG
GGTCTTGTCCATATTCTGGCCCTGGGCGTCTTTGGCACGGGCTTTGTCAAGGATTTCCTGTCGCTTCCGCGTCCT
CTGTCTCCTCCTCTACACCGCATCACCATGTCGGGCTCAGCGGCCCTCGAATACGGTTTTCCTTCCACACACAGC
GCCAATGCCGTTTCAGTGGCTGTCTATGCCCTCTTGCTCCTGCACAGCCCAGCCAGTACACTATCAGAGCCCACA
AAGCTGTTGCTCGAGGCGCTCTGCTACTTTTACGCCGCATCCATTGTCTTTGGCCGTCTCTACTGCGGCATGCAC
GGCTTTCTCGACGTGGCCGTAGGCTCCTTGTTTGGTGTGGCCATTGGATGGCTAGAATTTACCTATGGTCCCTGC
CTAAACCAGTACCTGTACTCGAGCTCATGGCTTGTGCCTCTGCTCGCCAGCATCATCATTGTCGTCTTTGTCGGC
TTACATCCCGAGCCTGCTGATGACTGCCCTTGCTTTGACGACAGCGTAGCTTTTGCCGGTGTCTTGATTGGGCTC
GAGTTCGGCACATGGACGTACAGCAAAAGCTCGCCTGATGCCGCTGGCCACGACTCCATACCCCTTGGTCTGGCG
CTCAACGTGGCACGCATCGTCTTGGGCGTACTTGTCATTTTTGCCTGGCGTGAGACGATGAAGCCGACGCTGCTC
AAGCTGTTGCCCCATCTGTTTCGTTGGATGGAGCACCTTGGCTGGAGCTTGCCGAGGCGCTTCTTCACTCCAGCC
ACTGAGTACAAGTCGGTTCCTATTGGCTCGCGACTTGATACTCTGTTTCCTGCCGCTGCTGATTTCCCTCGCATG
GTGCAAGGCATCCGCCATCCCACCACTAGGGGCAGATCTGTGTCGATTGGGCCTCAGAGTGCTGCTGATGCGTAC
GAGACGCTGGCTTATCGTGAGCTCCGTCGCCGAGAGAGTGTGGCCACGGGTGTTAGTGACGATGCTACCCTTGAC
GACGAGCTCGTTGGCAGTGCTCGCAGGGATCGAGACTGCTCAGGCCGGGACGCCCAGTCAAGTGCAGTACAGAGA
CATGCTCTGGCGCGCCACGACCATGAGACAATGGCTAATGGCAGTGCTGCCAGCCACGTTGCCGAAGCGCGCCTC
GAGGAGAAGCAAATGTTTTCTCTACTTGTAAGGCCGCGAGTCAGATATGATGTCGAAGTCGTCACAAAGCTGGTC
ATTTATGCAGGCATCGCTGGTCTTGCAACGGCGCTGATTCCTCTCGGTTTTGAGCTGGTTGGCTTGGATGCTAGA
GGCTCGTAG
Gene >OphauB2|1581
ATGATCGTCTCTCCTCGTTGTCGCCATCACGCCGTCTTGCCCGTCTTGCTCCTCAATGTCGTCGCCTCGAGCTTC
ATCCTCAACACCATCTGCTTCATCGTCACTCTCGCCGCCGCCCTCGTGCAAATCCCGCCTCGCCATCCACCTCGG
CCTGCCCTGTCTTCCGCACTGCGCTGCGCGCCGCCTGCGATTTCCACCATGAGCGGCCCCGGGCGCCCGCCTTCG
CCCGATGCACAGCCTTGCAATGGCAAGCTGGTGGCTCCCGACGCCGACAGTGTCCCCGAGGCCGGTCTTAGGAGT
CTCGACCACTGTGAGCCATTGTCCGTGGCCAGAGGCTTGATGCCGGCGCTGATTGCCCCTTTTCAGACAGGAAAG
CGTTGCCGCCATGGCGCTATGCCATTCGCCACAAGATGCTGCCTCTGATCCGCTGCGAGACGCCTTACCTGGCTG
GCCTGCAGCAGGCGCTGCGCACACCGGCCCTCGACAGCTACTTTGCCATCACGGCCAACTTGGGCACCCATACCT
TTTTCATGGTTGGCCTGCCCATTACCTTTTGGTGCGGACACGCGTCGTTTGGAAAGGGGTGCGTCGTCGAGCCTC
GACAAGTGCGGGATGCTGGCTGACCATGTCTTAGTCTTGTCCATATTCTGGCCCTGGGCGTCTTTGGCACGGGCT
TTGTCAAGGATTTCCTGTCGCTTCCGCGTCCTCTGTCTCCTCCTCTACACCGCATCACCATGTCGGGCTCAGCGG
CCCTCGAATACGGTTTTCCTTCCACACACAGCGCCAATGCCGTTTCAGTGGCTGTCTATGCCCTCTTGCTCCTGC
ACAGCCCAGCCAGTACACTATCAGAGCCCACAAAGCTGTTGCTCGAGGCGCTCTGCTACTTTTACGCCGCATCCA
TTGTCTTTGGCCGTCTCTACTGCGGCATGCACGGCTTTCTCGACGTGGCCGTAGGCTCCTTGTTTGGTGTGGCCA
TTGGATGGCTAGAATTTACCTATGGTCCCTGCCTAAACCAGTACCTGTACTCGAGCTCATGGCTTGTGCCTCTGC
TCGCCAGCATCATCATTGTCGTCTTTGTCGGCTTACATCCCGAGCCTGCTGATGACTGCCCTTGCTTTGACGACA
GCGTAGCTTTTGCCGGTGTCTTGATTGGGCTCGAGTTCGGCACATGGACGTACAGCAAAAGCTCGCCTGATGCCG
CTGGCCACGACTCCATACCCCTTGGTCTGGCGCTCAACGTGGCACGCATCGTCTTGGGCGTACTTGTCATTTTTG
CCTGGCGTGAGACGATGAAGCCGACGCTGCTCAAGCTGTTGCCCCATCTGTTTCGTTGGATGGAGCACCTTGGCT
GGAGCTTGCCGAGGCGCTTCTTCACTCCAGCCACTGAGTACAAGTCGGTTCCTATTGGCTCGCGACTTGATACTC
TGTTTCCTGCCGCTGCTGATTTCCCTCGCATGGTGCAAGGCATCCGCCATCCCACCACTAGGGGCAGATCTGTGT
CGATTGGGCCTCAGAGTGCTGCTGATGCGTACGAGACGCTGGCTTATCGTGAGCTCCGTCGCCGAGAGAGTGTGG
CCACGGGTGTTAGTGACGATGCTACCCTTGACGACGAGCTCGTTGGCAGTGCTCGCAGGGATCGAGACTGCTCAG
GCCGGGACGCCCAGTCAAGTGCAGTACAGAGACATGCTCTGGCGCGCCACGACCATGAGACAATGGCTAATGGCA
GTGCTGCCAGCCACGTTGCCGAAGCGCGCCTCGAGGAGAAGCAAATGTTTTCTCTACTTGTAAGGCCGCGAGTCA
GATATGATGTCGAAGTCGTCACAAAGCTGGTCATTTATGCAGGTGAGATTGCCAGTGTCATTTAATTTCTTTTTC
TTCTTGTTTATAATGGCGTCGTCGCTGACAGACTGCCTAGGCATCGCTGGTCTTGCAACGGCGCTGATTCCTCTC
GGTTTTGAGCTGGTTGGCTTGGATGCTAGAGGCTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail