Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1569
Gene name
LocationContig_142:4912..6965
Strand-
Gene length (bp)2053
Transcript length (bp)1986
Coding sequence length (bp)1986
Protein length (aa) 662

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00285 Citrate_synt Citrate synthase, C-terminal domain 3.6E-17 433 628
PF02629 CoA_binding CoA binding domain 4.8E-19 43 148
PF00549 Ligase_CoA CoA-ligase 3.5E-14 208 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93988|ACL1_SORMK ATP-citrate synthase subunit 1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=ACL1 PE=3 SV=1 12 661 0.0E+00
sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.310 PE=3 SV=1 4 661 0.0E+00
sp|Q9FGX1|ACLB2_ARATH ATP-citrate synthase beta chain protein 2 OS=Arabidopsis thaliana GN=ACLB-2 PE=1 SV=1 40 641 0.0E+00
sp|Q9C522|ACLB1_ARATH ATP-citrate synthase beta chain protein 1 OS=Arabidopsis thaliana GN=ACLB-1 PE=2 SV=1 40 641 0.0E+00
sp|Q93VT8|ACLB1_ORYSJ ATP-citrate synthase beta chain protein 1 OS=Oryza sativa subsp. japonica GN=ACLB-1 PE=2 SV=1 40 641 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93988|ACL1_SORMK ATP-citrate synthase subunit 1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=ACL1 PE=3 SV=1 12 661 0.0E+00
sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.310 PE=3 SV=1 4 661 0.0E+00
sp|Q9FGX1|ACLB2_ARATH ATP-citrate synthase beta chain protein 2 OS=Arabidopsis thaliana GN=ACLB-2 PE=1 SV=1 40 641 0.0E+00
sp|Q9C522|ACLB1_ARATH ATP-citrate synthase beta chain protein 1 OS=Arabidopsis thaliana GN=ACLB-1 PE=2 SV=1 40 641 0.0E+00
sp|Q93VT8|ACLB1_ORYSJ ATP-citrate synthase beta chain protein 1 OS=Oryza sativa subsp. japonica GN=ACLB-1 PE=2 SV=1 40 641 0.0E+00
sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyostelium discoideum GN=acly PE=1 SV=1 33 643 0.0E+00
sp|P53585|ACLY_CAEEL Probable ATP-citrate synthase OS=Caenorhabditis elegans GN=D1005.1 PE=3 SV=1 40 644 0.0E+00
sp|Q2TCH3|ACLY_SHEEP ATP-citrate synthase OS=Ovis aries GN=ACLY PE=2 SV=1 26 645 0.0E+00
sp|P16638|ACLY_RAT ATP-citrate synthase OS=Rattus norvegicus GN=Acly PE=1 SV=1 26 645 0.0E+00
sp|P53396|ACLY_HUMAN ATP-citrate synthase OS=Homo sapiens GN=ACLY PE=1 SV=3 26 644 0.0E+00
sp|Q91V92|ACLY_MOUSE ATP-citrate synthase OS=Mus musculus GN=Acly PE=1 SV=1 26 645 0.0E+00
sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1703.07 PE=1 SV=1 36 642 0.0E+00
sp|Q32PF2|ACLY_BOVIN ATP-citrate synthase OS=Bos taurus GN=ACLY PE=2 SV=1 40 645 0.0E+00
sp|P45102|SUCD_HAEIN Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=sucD PE=3 SV=1 86 350 8.0E-26
sp|O28098|SUCD2_ARCFU Succinyl-CoA ligase [ADP-forming] subunit alpha 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sucD2 PE=3 SV=1 40 337 1.0E-23
sp|O26663|SUCD_METTH Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=sucD PE=3 SV=1 40 331 1.0E-23
sp|O28733|SUCD1_ARCFU Succinyl-CoA ligase [ADP-forming] subunit alpha 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=sucD1 PE=3 SV=1 40 350 3.0E-23
sp|P68209|SUCA1_ARATH Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Arabidopsis thaliana GN=At5g08300 PE=1 SV=1 34 359 8.0E-23
sp|P53591|SUCD_COXBU Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sucD PE=3 SV=2 40 337 2.0E-22
sp|Q8GTQ9|SUCA1_SOLLC Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial OS=Solanum lycopersicum GN=SCOA PE=1 SV=1 1 351 2.0E-22
sp|Q51567|SUCD_PSEAE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sucD PE=3 SV=2 92 354 4.0E-22
sp|P0AGE9|SUCD_ECOLI Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli (strain K12) GN=sucD PE=1 SV=2 92 350 5.0E-22
sp|P0AGF0|SUCD_ECOL6 Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sucD PE=3 SV=2 92 350 5.0E-22
sp|P0AGF1|SUCD_ECO57 Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Escherichia coli O157:H7 GN=sucD PE=3 SV=2 92 350 5.0E-22
sp|Q6DQL1|SUCA2_SOLLC Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Solanum lycopersicum PE=1 SV=1 33 351 1.0E-21
sp|Q8LAD2|SUCA2_ARATH Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial OS=Arabidopsis thaliana GN=At5g23250 PE=2 SV=2 33 334 4.0E-21
sp|Q9AKE1|SUCD_RICTY Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sucD PE=3 SV=1 40 352 9.0E-20
sp|Q58643|SUCD_METJA Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=sucD PE=1 SV=1 40 348 2.0E-19
sp|Q92I22|SUCD_RICCN Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sucD PE=3 SV=1 40 341 3.0E-19
sp|O08371|SUCD_RICPR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia prowazekii (strain Madrid E) GN=sucD PE=3 SV=1 40 352 4.0E-19
sp|P53595|MTKB_METEA Malate--CoA ligase subunit alpha OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=mtkB PE=3 SV=2 92 338 4.0E-19
sp|Q7U0Z0|SUCD_MYCBO Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sucD PE=3 SV=1 98 337 4.0E-19
sp|P9WGC7|SUCD_MYCTU Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sucD PE=1 SV=1 98 337 5.0E-19
sp|P9WGC6|SUCD_MYCTO Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sucD PE=3 SV=1 98 337 5.0E-19
sp|Q6ZL94|SUCA_ORYSJ Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0577700 PE=1 SV=1 36 351 6.0E-19
sp|P80865|SUCD_BACSU Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Bacillus subtilis (strain 168) GN=sucD PE=1 SV=3 92 355 2.0E-18
sp|Q4ULQ8|SUCD_RICFE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sucD PE=3 SV=1 40 341 2.0E-18
sp|Q1RH56|SUCD_RICBR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Rickettsia bellii (strain RML369-C) GN=sucD PE=3 SV=1 40 341 2.0E-18
sp|P09143|SUCD_THETH Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Thermus thermophilus GN=sucD PE=1 SV=1 40 347 2.0E-17
sp|Q5HPU4|SUCD_STAEQ Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=sucD PE=3 SV=1 39 353 2.0E-17
sp|Q8CPH4|SUCD_STAES Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus epidermidis (strain ATCC 12228) GN=sucD PE=3 SV=1 39 353 3.0E-17
sp|P13086|SUCA_RAT Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Rattus norvegicus GN=Suclg1 PE=2 SV=2 98 297 4.0E-16
sp|P99070|SUCD_STAAN Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain N315) GN=sucD PE=1 SV=1 39 353 5.0E-16
sp|P66866|SUCD_STAAM Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=sucD PE=3 SV=1 39 353 5.0E-16
sp|Q5HGI6|SUCD_STAAC Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain COL) GN=sucD PE=3 SV=1 39 353 5.0E-16
sp|Q8NX01|SUCD_STAAW Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain MW2) GN=sucD PE=3 SV=1 39 353 7.0E-16
sp|Q6G9W7|SUCD_STAAS Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain MSSA476) GN=sucD PE=3 SV=1 39 353 7.0E-16
sp|Q6GHI9|SUCD_STAAR Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Staphylococcus aureus (strain MRSA252) GN=sucD PE=3 SV=1 39 353 9.0E-16
sp|P53596|SUCA_CAEEL Probable succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=C05G5.4 PE=3 SV=1 41 349 8.0E-15
sp|O13750|SUCA_SCHPO Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.17c PE=3 SV=1 142 337 2.0E-14
sp|P53598|SUCA_YEAST Succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSC1 PE=1 SV=1 99 334 2.0E-13
sp|P53400|SUCA2_TRIVA Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial OS=Trichomonas vaginalis GN=ALPHA-SCS2 PE=3 SV=1 98 358 3.0E-13
sp|Q94522|SUCA_DROME Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Drosophila melanogaster GN=Scsalpha PE=2 SV=3 86 341 9.0E-12
sp|P53401|SUCA3_TRIVA Succinyl-CoA ligase [GDP-forming] subunit alpha-3, mitochondrial OS=Trichomonas vaginalis GN=ALPHA-SCS3 PE=3 SV=1 98 358 2.0E-11
sp|P53399|SUCA1_TRIVA Succinyl-CoA ligase [GDP-forming] subunit alpha-1, mitochondrial OS=Trichomonas vaginalis GN=ALPHA-SCS1 PE=3 SV=1 92 358 7.0E-11
sp|P36967|SUCA_DICDI Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=scsA PE=1 SV=3 86 318 1.0E-10
sp|Q9WUM5|SUCA_MOUSE Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus GN=Suclg1 PE=1 SV=4 98 256 3.0E-10
sp|Q9P727|SUCA_NEUCR Probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=8D4.130 PE=3 SV=1 99 349 8.0E-10
sp|Q9YGD2|SUCA_COLLI Succinyl-CoA ligase subunit alpha, mitochondrial (Fragment) OS=Columba livia GN=SUCLG1 PE=1 SV=1 86 257 8.0E-10
sp|O19069|SUCA_PIG Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Sus scrofa GN=SUCLG1 PE=1 SV=2 138 297 2.0E-09
sp|Q58DR8|SUCA_BOVIN Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Bos taurus GN=SUCLG1 PE=2 SV=3 98 297 2.0E-09
sp|O67547|SUCD_AQUAE Succinyl-CoA ligase [ADP-forming] subunit alpha OS=Aquifex aeolicus (strain VF5) GN=sucD PE=3 SV=1 40 334 1.0E-08
sp|P53597|SUCA_HUMAN Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens GN=SUCLG1 PE=1 SV=4 142 297 4.0E-08
sp|D4GS06|CISY_HALVD Citrate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=citZ PE=1 SV=1 435 624 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0046912 acyltransferase activity, acyl groups converted into alkyl on transfer Yes
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1569
MAQASSSAAGGAKGQLSANDNIQRFAAPSRPLSPLPEHALFNDKTRCFVYGLQPRAVQGMLDFDFICKRKTPSVA
GIIYTFGGQFVSKMYWGTSETLLPVYQEVSKAISKHPDVDVVVNFASSRSVYSSTMELMEYPQIKTIAIIAEGVP
ERRAREIAHVAKKKGVTIIGPATVGGIKPGSFKIGNTGGMMDNIVASKLYRKGSVGYVSKSGGMSNELNNIISQT
TDGVYEGIAIGGDRYPGTTFIDHMLRYQADPECKILVLLGEVGGVEEYKVIDAVKKGIITKPIVAWAIGTCASMF
KTEVQFGHAGSFANSQLETAAMKNKMMTEAGFHVPKTFEDMPTVLKNVYEQLVKDGTIKPQPEPVVPKIPIDYSW
AQELGLIRKPAAFISTISDDRGQELLYAGMPISDVFREEIGIGGVMSLLWFRRRLPDYASKFLEMVLMLTADHGP
AVSGAMNTIITTRAGKDLISALVSGLLTIGSRFGGALDGAADEFTRAFDKNLSPREFVDSMRKANKLIPGIGHRI
KSRNNPDLRVELVKEYVLAKFPSHKLLDYALAVETVTTSKKDNLILNVDGCIAVCFVDLLRNCGAFSPEEAEDYL
KMGVLNGLFVLGRSIGLIAHYLDQKRLRTGLYRHPWDDITYLLPNLRDGRPGAEGRVEVQM*
Coding >OphauB2|1569
ATGGCTCAAGCTTCCTCAAGCGCCGCTGGTGGCGCAAAGGGCCAGTTGTCTGCCAACGACAACATCCAGCGCTTT
GCTGCGCCCAGTCGCCCTCTTAGCCCTTTGCCAGAGCACGCTCTCTTCAACGACAAGACGCGATGCTTCGTCTAC
GGTCTCCAGCCCCGCGCTGTCCAAGGCATGCTCGACTTCGACTTCATCTGCAAGCGCAAGACGCCTTCGGTCGCC
GGCATCATCTATACCTTTGGTGGCCAGTTCGTCAGCAAGATGTACTGGGGCACTAGCGAGACTCTGCTGCCCGTG
TACCAGGAGGTCAGCAAGGCTATTAGCAAGCACCCCGACGTCGACGTTGTCGTCAACTTTGCTTCCTCGCGCAGC
GTCTACAGCTCCACCATGGAGCTCATGGAATATCCCCAAATCAAAACCATTGCCATCATTGCCGAAGGTGTGCCT
GAGCGACGAGCCCGCGAGATTGCCCATGTGGCCAAGAAGAAGGGCGTCACCATCATTGGCCCCGCCACTGTGGGT
GGCATCAAGCCCGGCAGCTTCAAGATTGGAAATACCGGTGGCATGATGGACAATATTGTCGCCTCCAAGCTTTAC
CGCAAGGGCTCCGTCGGCTACGTCTCCAAATCGGGCGGCATGTCCAACGAATTGAACAACATCATCTCTCAGACG
ACCGACGGCGTGTACGAGGGCATTGCAATTGGTGGTGATCGCTACCCTGGCACCACCTTTATCGACCATATGCTC
CGCTACCAGGCCGACCCCGAATGCAAAATCCTCGTCTTGCTCGGTGAGGTGGGTGGGGTGGAAGAATACAAGGTG
ATTGACGCTGTCAAAAAGGGCATCATCACCAAGCCCATCGTTGCCTGGGCTATCGGCACCTGCGCCAGCATGTTC
AAGACCGAGGTCCAGTTTGGTCATGCTGGGTCCTTTGCCAATTCTCAGCTTGAAACGGCTGCCATGAAGAACAAG
ATGATGACTGAGGCCGGCTTCCACGTGCCCAAGACATTCGAGGACATGCCCACAGTTCTCAAGAATGTCTATGAA
CAACTTGTCAAGGATGGCACCATTAAGCCGCAACCCGAGCCTGTCGTGCCCAAGATCCCTATTGACTATTCGTGG
GCTCAAGAGCTCGGCCTCATCCGAAAGCCAGCCGCCTTTATTTCAACCATATCCGACGACCGTGGCCAAGAGCTT
CTTTACGCTGGCATGCCCATCTCGGATGTCTTCCGTGAGGAGATTGGCATAGGGGGCGTCATGTCATTGCTTTGG
TTCCGCCGCCGTCTACCAGACTACGCCTCCAAGTTTCTCGAAATGGTACTCATGCTTACTGCCGACCACGGCCCT
GCAGTATCTGGAGCCATGAACACCATCATCACGACGCGTGCCGGGAAAGACCTCATCAGTGCTCTTGTTTCTGGT
TTGCTGACAATTGGCTCGCGCTTTGGCGGTGCGCTGGATGGAGCCGCCGACGAGTTCACCAGAGCCTTTGACAAG
AACTTGAGCCCACGAGAATTTGTTGACAGCATGCGAAAGGCCAACAAACTCATACCCGGCATCGGCCATCGCATC
AAGTCGCGCAATAATCCTGATTTGCGTGTCGAGCTGGTCAAGGAGTATGTCTTGGCAAAATTTCCCAGCCACAAA
CTCCTCGACTACGCCCTGGCTGTTGAGACTGTCACCACGTCGAAAAAGGACAATCTTATTCTCAACGTGGATGGA
TGTATTGCTGTTTGCTTTGTTGATTTGCTACGCAACTGCGGTGCCTTTTCCCCAGAAGAGGCCGAGGACTACCTG
AAGATGGGCGTCCTCAACGGTCTCTTCGTGCTTGGTCGCAGCATTGGTCTGATTGCTCACTATCTCGATCAAAAG
AGACTGCGGACTGGCCTGTATCGTCATCCCTGGGATGACATTACTTACCTCCTCCCCAACCTGCGAGATGGACGG
CCTGGTGCCGAGGGAAGAGTAGAAGTTCAGATGTGA
Transcript >OphauB2|1569
ATGGCTCAAGCTTCCTCAAGCGCCGCTGGTGGCGCAAAGGGCCAGTTGTCTGCCAACGACAACATCCAGCGCTTT
GCTGCGCCCAGTCGCCCTCTTAGCCCTTTGCCAGAGCACGCTCTCTTCAACGACAAGACGCGATGCTTCGTCTAC
GGTCTCCAGCCCCGCGCTGTCCAAGGCATGCTCGACTTCGACTTCATCTGCAAGCGCAAGACGCCTTCGGTCGCC
GGCATCATCTATACCTTTGGTGGCCAGTTCGTCAGCAAGATGTACTGGGGCACTAGCGAGACTCTGCTGCCCGTG
TACCAGGAGGTCAGCAAGGCTATTAGCAAGCACCCCGACGTCGACGTTGTCGTCAACTTTGCTTCCTCGCGCAGC
GTCTACAGCTCCACCATGGAGCTCATGGAATATCCCCAAATCAAAACCATTGCCATCATTGCCGAAGGTGTGCCT
GAGCGACGAGCCCGCGAGATTGCCCATGTGGCCAAGAAGAAGGGCGTCACCATCATTGGCCCCGCCACTGTGGGT
GGCATCAAGCCCGGCAGCTTCAAGATTGGAAATACCGGTGGCATGATGGACAATATTGTCGCCTCCAAGCTTTAC
CGCAAGGGCTCCGTCGGCTACGTCTCCAAATCGGGCGGCATGTCCAACGAATTGAACAACATCATCTCTCAGACG
ACCGACGGCGTGTACGAGGGCATTGCAATTGGTGGTGATCGCTACCCTGGCACCACCTTTATCGACCATATGCTC
CGCTACCAGGCCGACCCCGAATGCAAAATCCTCGTCTTGCTCGGTGAGGTGGGTGGGGTGGAAGAATACAAGGTG
ATTGACGCTGTCAAAAAGGGCATCATCACCAAGCCCATCGTTGCCTGGGCTATCGGCACCTGCGCCAGCATGTTC
AAGACCGAGGTCCAGTTTGGTCATGCTGGGTCCTTTGCCAATTCTCAGCTTGAAACGGCTGCCATGAAGAACAAG
ATGATGACTGAGGCCGGCTTCCACGTGCCCAAGACATTCGAGGACATGCCCACAGTTCTCAAGAATGTCTATGAA
CAACTTGTCAAGGATGGCACCATTAAGCCGCAACCCGAGCCTGTCGTGCCCAAGATCCCTATTGACTATTCGTGG
GCTCAAGAGCTCGGCCTCATCCGAAAGCCAGCCGCCTTTATTTCAACCATATCCGACGACCGTGGCCAAGAGCTT
CTTTACGCTGGCATGCCCATCTCGGATGTCTTCCGTGAGGAGATTGGCATAGGGGGCGTCATGTCATTGCTTTGG
TTCCGCCGCCGTCTACCAGACTACGCCTCCAAGTTTCTCGAAATGGTACTCATGCTTACTGCCGACCACGGCCCT
GCAGTATCTGGAGCCATGAACACCATCATCACGACGCGTGCCGGGAAAGACCTCATCAGTGCTCTTGTTTCTGGT
TTGCTGACAATTGGCTCGCGCTTTGGCGGTGCGCTGGATGGAGCCGCCGACGAGTTCACCAGAGCCTTTGACAAG
AACTTGAGCCCACGAGAATTTGTTGACAGCATGCGAAAGGCCAACAAACTCATACCCGGCATCGGCCATCGCATC
AAGTCGCGCAATAATCCTGATTTGCGTGTCGAGCTGGTCAAGGAGTATGTCTTGGCAAAATTTCCCAGCCACAAA
CTCCTCGACTACGCCCTGGCTGTTGAGACTGTCACCACGTCGAAAAAGGACAATCTTATTCTCAACGTGGATGGA
TGTATTGCTGTTTGCTTTGTTGATTTGCTACGCAACTGCGGTGCCTTTTCCCCAGAAGAGGCCGAGGACTACCTG
AAGATGGGCGTCCTCAACGGTCTCTTCGTGCTTGGTCGCAGCATTGGTCTGATTGCTCACTATCTCGATCAAAAG
AGACTGCGGACTGGCCTGTATCGTCATCCCTGGGATGACATTACTTACCTCCTCCCCAACCTGCGAGATGGACGG
CCTGGTGCCGAGGGAAGAGTAGAAGTTCAGATGTGA
Gene >OphauB2|1569
ATGGCTCAAGCTTCCTCAAGCGCCGCTGGTGGCGCAAAGGGCCAGTTGTCTGCCAACGACAACATCCAGCGCTTT
GCTGCGCCCAGTCGCCCTCTTAGCCCTTTGCCAGAGCACGCTCTCTTCAACGACAAGACGCGATGCTTCGTCTAC
GGTCTCCAGCCCCGCGCTGTCCAAGGCATGCTCGACTTCGACTTCATCTGCAAGCGCAAGACGCCTTCGGTCGCC
GGCATCATCTATACCTTTGGTGGCCAGTTCGTCAGCAAGATGTACTGGGGCACTAGCGAGACTCTGCTGCCCGTG
TACCAGGAGGTCAGCAAGGCTATTAGCAAGCACCCCGACGTCGACGTTGTCGTCAACTTTGCTTCCTCGCGCAGC
GTCTACAGCTCCACCATGGAGCTCATGGAATATCCCCAAATCAAAACCATTGCCATCATTGCCGAAGGTGTGCCT
GAGCGAGTGAGTCTCCCCAAGACCTTGGCTGGCCCCCATTGACCATGTTGGGCTGACAATGTACCCTGTCCAGCG
AGCCCGCGAGATTGCCCATGTGGCCAAGAAGAAGGGCGTCACCATCATTGGCCCCGCCACTGTGGGTGGCATCAA
GCCCGGCAGCTTCAAGATTGGAAATACCGGTGGCATGATGGACAATATTGTCGCCTCCAAGCTTTACCGCAAGGG
CTCCGTCGGCTACGTCTCCAAATCGGGCGGCATGTCCAACGAATTGAACAACATCATCTCTCAGACGACCGACGG
CGTGTACGAGGGCATTGCAATTGGTGGTGATCGCTACCCTGGCACCACCTTTATCGACCATATGCTCCGCTACCA
GGCCGACCCCGAATGCAAAATCCTCGTCTTGCTCGGTGAGGTGGGTGGGGTGGAAGAATACAAGGTGATTGACGC
TGTCAAAAAGGGCATCATCACCAAGCCCATCGTTGCCTGGGCTATCGGCACCTGCGCCAGCATGTTCAAGACCGA
GGTCCAGTTTGGTCATGCTGGGTCCTTTGCCAATTCTCAGCTTGAAACGGCTGCCATGAAGAACAAGATGATGAC
TGAGGCCGGCTTCCACGTGCCCAAGACATTCGAGGACATGCCCACAGTTCTCAAGAATGTCTATGAACAACTTGT
CAAGGATGGCACCATTAAGCCGCAACCCGAGCCTGTCGTGCCCAAGATCCCTATTGACTATTCGTGGGCTCAAGA
GCTCGGCCTCATCCGAAAGCCAGCCGCCTTTATTTCAACCATATCCGACGACCGTGGCCAAGAGCTTCTTTACGC
TGGCATGCCCATCTCGGATGTCTTCCGTGAGGAGATTGGCATAGGGGGCGTCATGTCATTGCTTTGGTTCCGCCG
CCGTCTACCAGACTACGCCTCCAAGTTTCTCGAAATGGTACTCATGCTTACTGCCGACCACGGCCCTGCAGTATC
TGGAGCCATGAACACCATCATCACGACGCGTGCCGGGAAAGACCTCATCAGTGCTCTTGTTTCTGGTTTGCTGAC
AATTGGCTCGCGCTTTGGCGGTGCGCTGGATGGAGCCGCCGACGAGTTCACCAGAGCCTTTGACAAGAACTTGAG
CCCACGAGAATTTGTTGACAGCATGCGAAAGGCCAACAAACTCATACCCGGCATCGGCCATCGCATCAAGTCGCG
CAATAATCCTGATTTGCGTGTCGAGCTGGTCAAGGAGTATGTCTTGGCAAAATTTCCCAGCCACAAACTCCTCGA
CTACGCCCTGGCTGTTGAGACTGTCACCACGTCGAAAAAGGACAATCTTATTCTCAACGTGGATGGATGTATTGC
TGTTTGCTTTGTTGATTTGCTACGCAACTGCGGTGCCTTTTCCCCAGAAGAGGCCGAGGACTACCTGAAGATGGG
CGTCCTCAACGGTCTCTTCGTGCTTGGTCGCAGCATTGGTCTGATTGCTCACTATCTCGATCAAAAGAGACTGCG
GACTGGCCTGTATCGTCATCCCTGGGATGACATTACTTACCTCCTCCCCAACCTGCGAGATGGACGGCCTGGTGC
CGAGGGAAGAGTAGAAGTTCAGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail