Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1566
Gene name
LocationContig_142:1408..2137
Strand+
Gene length (bp)729
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11717 Tudor-knot RNA binding activity-knot of a chromodomain 6.5E-07 15 66

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WPW2|EAF3_ASPFU Chromatin modification-related protein eaf3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eaf3 PE=3 SV=1 1 136 2.0E-28
sp|Q5BBV4|EAF3_EMENI Chromatin modification-related protein eaf3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eaf3 PE=3 SV=1 11 136 2.0E-27
sp|O13953|EAF3_SCHPO Chromatin modification-related protein eaf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp13 PE=1 SV=1 11 79 3.0E-12
sp|Q9Y0I1|EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster GN=MRG15 PE=1 SV=1 8 96 2.0E-11
sp|Q6AYU1|MO4L1_RAT Mortality factor 4-like protein 1 OS=Rattus norvegicus GN=Morf4l1 PE=2 SV=1 1 122 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WPW2|EAF3_ASPFU Chromatin modification-related protein eaf3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eaf3 PE=3 SV=1 1 136 2.0E-28
sp|Q5BBV4|EAF3_EMENI Chromatin modification-related protein eaf3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eaf3 PE=3 SV=1 11 136 2.0E-27
sp|O13953|EAF3_SCHPO Chromatin modification-related protein eaf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp13 PE=1 SV=1 11 79 3.0E-12
sp|Q9Y0I1|EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster GN=MRG15 PE=1 SV=1 8 96 2.0E-11
sp|Q6AYU1|MO4L1_RAT Mortality factor 4-like protein 1 OS=Rattus norvegicus GN=Morf4l1 PE=2 SV=1 1 122 4.0E-11
sp|Q6CND0|EAF3_KLULA Chromatin modification-related protein EAF3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EAF3 PE=3 SV=1 14 115 1.0E-10
sp|Q5NVP9|MO4L1_PONAB Mortality factor 4-like protein 1 OS=Pongo abelii GN=MORF4L1 PE=2 SV=1 1 70 2.0E-10
sp|Q12432|EAF3_YEAST Chromatin modification-related protein EAF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAF3 PE=1 SV=1 10 125 5.0E-10
sp|Q6BT38|EAF3_DEBHA Chromatin modification-related protein EAF3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EAF3 PE=3 SV=1 11 138 2.0E-09
sp|Q6FN68|EAF3_CANGA Chromatin modification-related protein EAF3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EAF3 PE=3 SV=1 11 129 3.0E-09
sp|P0CO87|EAF3_CRYNB Chromatin modification-related protein EAF3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EAF3 PE=3 SV=1 9 70 4.0E-09
sp|P0CO86|EAF3_CRYNJ Chromatin modification-related protein EAF3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EAF3 PE=3 SV=1 9 70 4.0E-09
sp|Q94C32|MRG1_ARATH Protein MRG1 OS=Arabidopsis thaliana GN=MRG1 PE=1 SV=1 11 124 8.0E-09
sp|Q75AH9|EAF3_ASHGO Chromatin modification-related protein EAF3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EAF3 PE=3 SV=2 11 79 8.0E-09
sp|Q4P827|EAF3_USTMA Chromatin modification-related protein EAF3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EAF3 PE=3 SV=2 11 84 2.0E-08
sp|Q5R6Y9|MS3L1_PONAB Male-specific lethal 3 homolog OS=Pongo abelii GN=MSL3 PE=2 SV=1 10 105 3.0E-08
sp|Q8N5Y2|MS3L1_HUMAN Male-specific lethal 3 homolog OS=Homo sapiens GN=MSL3 PE=1 SV=1 10 105 3.0E-08
sp|Q9WVG9|MS3L1_MOUSE Male-specific lethal 3 homolog OS=Mus musculus GN=Msl3 PE=1 SV=3 10 105 4.0E-08
sp|Q54RM0|EAF3_DICDI NuA4 complex subunit EAF3 homolog OS=Dictyostelium discoideum GN=DDB_G0283075 PE=3 SV=1 11 75 5.0E-08
sp|Q4V3E2|MRG2_ARATH Protein MRG2 OS=Arabidopsis thaliana GN=MRG2 PE=1 SV=1 11 91 2.0E-07
sp|P60762|MO4L1_MOUSE Mortality factor 4-like protein 1 OS=Mus musculus GN=Morf4l1 PE=1 SV=2 1 52 7.0E-06
sp|Q9UBU8|MO4L1_HUMAN Mortality factor 4-like protein 1 OS=Homo sapiens GN=MORF4L1 PE=1 SV=2 1 52 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1194
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|26
Ophiocordyceps australis map64 (Brazil) OphauB2|1566 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05767
Ophiocordyceps camponoti-rufipedis Ophun1|6017
Ophiocordyceps kimflemingae Ophio5|5976
Ophiocordyceps subramaniannii Hirsu2|1034

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1566
MPPTRQQNPQFAKDEKVLCFHMDMLYEAKIMEVQSGDKPGDGFRYKVHYKGWKNTWDDWVLADRIRAFDDEHKEL
AAQLHAQLKQSMSKSSKQPKRGIKAGADSARGSEERTSTSLQGARGGRRTKDWELEQVGGFVKLFLTRVWSLLYR
HVPLPLAHFKLLTNGTLVKCETARFKSLSPLHAQTTHHLYSLGCSLITDSITASWGSVYLPMGSIYVAKRNFELA
QIQQLITRRFLVCYKVP*
Coding >OphauB2|1566
ATGCCCCCTACGAGGCAGCAAAACCCTCAATTCGCCAAGGACGAGAAGGTTCTGTGCTTCCACATGGACATGCTT
TACGAAGCCAAGATTATGGAAGTGCAGTCAGGCGATAAGCCAGGTGATGGCTTCCGCTACAAGGTTCACTATAAG
GGTTGGAAAAATACCTGGGACGACTGGGTCCTGGCCGACCGCATACGCGCCTTTGACGACGAGCACAAGGAGCTA
GCGGCACAGCTTCATGCCCAGCTCAAGCAAAGCATGAGTAAGAGCTCTAAGCAGCCCAAAAGAGGCATCAAGGCC
GGTGCCGATTCAGCACGCGGCAGTGAGGAGCGAACTTCGACTTCTCTTCAAGGCGCGCGAGGCGGACGTCGAACC
AAGGACTGGGAACTCGAACAGGTTGGTGGCTTTGTCAAGCTTTTTCTTACTCGTGTTTGGTCCTTGTTGTACCGC
CATGTGCCTTTGCCCCTTGCCCACTTCAAGTTGTTGACCAACGGCACGCTTGTCAAGTGCGAGACTGCCCGTTTC
AAGAGTTTATCTCCCCTCCATGCACAGACCACACATCACCTTTACTCGCTTGGCTGCAGCCTCATAACCGATTCA
ATTACTGCCAGTTGGGGTTCAGTATATCTGCCAATGGGCTCGATTTATGTCGCCAAACGAAACTTTGAGCTGGCG
CAAATACAGCAGCTAATCACTCGTCGTTTTCTGGTGTGCTATAAAGTGCCCTAG
Transcript >OphauB2|1566
ATGCCCCCTACGAGGCAGCAAAACCCTCAATTCGCCAAGGACGAGAAGGTTCTGTGCTTCCACATGGACATGCTT
TACGAAGCCAAGATTATGGAAGTGCAGTCAGGCGATAAGCCAGGTGATGGCTTCCGCTACAAGGTTCACTATAAG
GGTTGGAAAAATACCTGGGACGACTGGGTCCTGGCCGACCGCATACGCGCCTTTGACGACGAGCACAAGGAGCTA
GCGGCACAGCTTCATGCCCAGCTCAAGCAAAGCATGAGTAAGAGCTCTAAGCAGCCCAAAAGAGGCATCAAGGCC
GGTGCCGATTCAGCACGCGGCAGTGAGGAGCGAACTTCGACTTCTCTTCAAGGCGCGCGAGGCGGACGTCGAACC
AAGGACTGGGAACTCGAACAGGTTGGTGGCTTTGTCAAGCTTTTTCTTACTCGTGTTTGGTCCTTGTTGTACCGC
CATGTGCCTTTGCCCCTTGCCCACTTCAAGTTGTTGACCAACGGCACGCTTGTCAAGTGCGAGACTGCCCGTTTC
AAGAGTTTATCTCCCCTCCATGCACAGACCACACATCACCTTTACTCGCTTGGCTGCAGCCTCATAACCGATTCA
ATTACTGCCAGTTGGGGTTCAGTATATCTGCCAATGGGCTCGATTTATGTCGCCAAACGAAACTTTGAGCTGGCG
CAAATACAGCAGCTAATCACTCGTCGTTTTCTGGTGTGCTATAAAGTGCCCTAG
Gene >OphauB2|1566
ATGCCCCCTACGAGGCAGCAAAACCCTCAATTCGCCAAGGACGAGAAGGTTCTGTGCTTCCACATGGACATGCTT
TACGAAGCCAAGATTATGGAAGTGCAGTCAGGCGATAAGCCAGGTGATGGCTTCCGCTACAAGGTTCACTATAAG
GGTTGGAAAAATACCTGGGACGACTGGGTCCTGGCCGACCGCATACGCGCCTTTGACGACGAGCACAAGGAGCTA
GCGGCACAGCTTCATGCCCAGCTCAAGCAAAGCATGAGTAAGAGCTCTAAGCAGCCCAAAAGAGGCATCAAGGCC
GGTGCCGATTCAGCACGCGGCAGTGAGGAGCGAACTTCGACTTCTCTTCAAGGCGCGCGAGGCGGACGTCGAACC
AAGGACTGGGAACTCGAACAGGTTGGTGGCTTTGTCAAGCTTTTTCTTACTCGTGTTTGGTCCTTGTTGTACCGC
CATGTGCCTTTGCCCCTTGCCCACTTCAAGTTGTTGACCAACGGCACGCTTGTCAAGTGCGAGACTGCCCGTTTC
AAGAGTTTATCTCCCCTCCATGCACAGACCACACATCACCTTTACTCGCTTGGCTGCAGCCTCATAACCGATTCA
ATTACTGCCAGTTGGGGTTCAGTATATCTGCCAATGGGCTCGATTTATGTCGCCAAACGAAACTTTGAGCTGGCG
CAAATACAGCAGCTAATCACTCGTCGTTTTCTGGTGTGCTATAAAGTGCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail