Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1566
Gene name
LocationContig_142:1408..2137
Strand+
Gene length (bp)729
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11717 Tudor-knot RNA binding activity-knot of a chromodomain 6.5E-07 15 66

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WPW2|EAF3_ASPFU Chromatin modification-related protein eaf3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eaf3 PE=3 SV=1 1 136 2.0E-28
sp|Q5BBV4|EAF3_EMENI Chromatin modification-related protein eaf3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eaf3 PE=3 SV=1 11 136 2.0E-27
sp|O13953|EAF3_SCHPO Chromatin modification-related protein eaf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp13 PE=1 SV=1 11 79 3.0E-12
sp|Q9Y0I1|EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster GN=MRG15 PE=1 SV=1 8 96 2.0E-11
sp|Q6AYU1|MO4L1_RAT Mortality factor 4-like protein 1 OS=Rattus norvegicus GN=Morf4l1 PE=2 SV=1 1 122 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WPW2|EAF3_ASPFU Chromatin modification-related protein eaf3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eaf3 PE=3 SV=1 1 136 2.0E-28
sp|Q5BBV4|EAF3_EMENI Chromatin modification-related protein eaf3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eaf3 PE=3 SV=1 11 136 2.0E-27
sp|O13953|EAF3_SCHPO Chromatin modification-related protein eaf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp13 PE=1 SV=1 11 79 3.0E-12
sp|Q9Y0I1|EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster GN=MRG15 PE=1 SV=1 8 96 2.0E-11
sp|Q6AYU1|MO4L1_RAT Mortality factor 4-like protein 1 OS=Rattus norvegicus GN=Morf4l1 PE=2 SV=1 1 122 4.0E-11
sp|Q6CND0|EAF3_KLULA Chromatin modification-related protein EAF3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EAF3 PE=3 SV=1 14 115 1.0E-10
sp|Q5NVP9|MO4L1_PONAB Mortality factor 4-like protein 1 OS=Pongo abelii GN=MORF4L1 PE=2 SV=1 1 70 2.0E-10
sp|Q12432|EAF3_YEAST Chromatin modification-related protein EAF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAF3 PE=1 SV=1 10 125 5.0E-10
sp|Q6BT38|EAF3_DEBHA Chromatin modification-related protein EAF3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EAF3 PE=3 SV=1 11 138 2.0E-09
sp|Q6FN68|EAF3_CANGA Chromatin modification-related protein EAF3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EAF3 PE=3 SV=1 11 129 3.0E-09
sp|P0CO87|EAF3_CRYNB Chromatin modification-related protein EAF3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EAF3 PE=3 SV=1 9 70 4.0E-09
sp|P0CO86|EAF3_CRYNJ Chromatin modification-related protein EAF3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EAF3 PE=3 SV=1 9 70 4.0E-09
sp|Q94C32|MRG1_ARATH Protein MRG1 OS=Arabidopsis thaliana GN=MRG1 PE=1 SV=1 11 124 8.0E-09
sp|Q75AH9|EAF3_ASHGO Chromatin modification-related protein EAF3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EAF3 PE=3 SV=2 11 79 8.0E-09
sp|Q4P827|EAF3_USTMA Chromatin modification-related protein EAF3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EAF3 PE=3 SV=2 11 84 2.0E-08
sp|Q5R6Y9|MS3L1_PONAB Male-specific lethal 3 homolog OS=Pongo abelii GN=MSL3 PE=2 SV=1 10 105 3.0E-08
sp|Q8N5Y2|MS3L1_HUMAN Male-specific lethal 3 homolog OS=Homo sapiens GN=MSL3 PE=1 SV=1 10 105 3.0E-08
sp|Q9WVG9|MS3L1_MOUSE Male-specific lethal 3 homolog OS=Mus musculus GN=Msl3 PE=1 SV=3 10 105 4.0E-08
sp|Q54RM0|EAF3_DICDI NuA4 complex subunit EAF3 homolog OS=Dictyostelium discoideum GN=DDB_G0283075 PE=3 SV=1 11 75 5.0E-08
sp|Q4V3E2|MRG2_ARATH Protein MRG2 OS=Arabidopsis thaliana GN=MRG2 PE=1 SV=1 11 91 2.0E-07
sp|P60762|MO4L1_MOUSE Mortality factor 4-like protein 1 OS=Mus musculus GN=Morf4l1 PE=1 SV=2 1 52 7.0E-06
sp|Q9UBU8|MO4L1_HUMAN Mortality factor 4-like protein 1 OS=Homo sapiens GN=MORF4L1 PE=1 SV=2 1 52 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1566
MPPTRQQNPQFAKDEKVLCFHMDMLYEAKIMEVQSGDKPGDGFRYKVHYKGWKNTWDDWVLADRIRAFDDEHKEL
AAQLHAQLKQSMSKSSKQPKRGIKAGADSARGSEERTSTSLQGARGGRRTKDWELEQVGGFVKLFLTRVWSLLYR
HVPLPLAHFKLLTNGTLVKCETARFKSLSPLHAQTTHHLYSLGCSLITDSITASWGSVYLPMGSIYVAKRNFELA
QIQQLITRRFLVCYKVP*
Coding >OphauB2|1566
ATGCCCCCTACGAGGCAGCAAAACCCTCAATTCGCCAAGGACGAGAAGGTTCTGTGCTTCCACATGGACATGCTT
TACGAAGCCAAGATTATGGAAGTGCAGTCAGGCGATAAGCCAGGTGATGGCTTCCGCTACAAGGTTCACTATAAG
GGTTGGAAAAATACCTGGGACGACTGGGTCCTGGCCGACCGCATACGCGCCTTTGACGACGAGCACAAGGAGCTA
GCGGCACAGCTTCATGCCCAGCTCAAGCAAAGCATGAGTAAGAGCTCTAAGCAGCCCAAAAGAGGCATCAAGGCC
GGTGCCGATTCAGCACGCGGCAGTGAGGAGCGAACTTCGACTTCTCTTCAAGGCGCGCGAGGCGGACGTCGAACC
AAGGACTGGGAACTCGAACAGGTTGGTGGCTTTGTCAAGCTTTTTCTTACTCGTGTTTGGTCCTTGTTGTACCGC
CATGTGCCTTTGCCCCTTGCCCACTTCAAGTTGTTGACCAACGGCACGCTTGTCAAGTGCGAGACTGCCCGTTTC
AAGAGTTTATCTCCCCTCCATGCACAGACCACACATCACCTTTACTCGCTTGGCTGCAGCCTCATAACCGATTCA
ATTACTGCCAGTTGGGGTTCAGTATATCTGCCAATGGGCTCGATTTATGTCGCCAAACGAAACTTTGAGCTGGCG
CAAATACAGCAGCTAATCACTCGTCGTTTTCTGGTGTGCTATAAAGTGCCCTAG
Transcript >OphauB2|1566
ATGCCCCCTACGAGGCAGCAAAACCCTCAATTCGCCAAGGACGAGAAGGTTCTGTGCTTCCACATGGACATGCTT
TACGAAGCCAAGATTATGGAAGTGCAGTCAGGCGATAAGCCAGGTGATGGCTTCCGCTACAAGGTTCACTATAAG
GGTTGGAAAAATACCTGGGACGACTGGGTCCTGGCCGACCGCATACGCGCCTTTGACGACGAGCACAAGGAGCTA
GCGGCACAGCTTCATGCCCAGCTCAAGCAAAGCATGAGTAAGAGCTCTAAGCAGCCCAAAAGAGGCATCAAGGCC
GGTGCCGATTCAGCACGCGGCAGTGAGGAGCGAACTTCGACTTCTCTTCAAGGCGCGCGAGGCGGACGTCGAACC
AAGGACTGGGAACTCGAACAGGTTGGTGGCTTTGTCAAGCTTTTTCTTACTCGTGTTTGGTCCTTGTTGTACCGC
CATGTGCCTTTGCCCCTTGCCCACTTCAAGTTGTTGACCAACGGCACGCTTGTCAAGTGCGAGACTGCCCGTTTC
AAGAGTTTATCTCCCCTCCATGCACAGACCACACATCACCTTTACTCGCTTGGCTGCAGCCTCATAACCGATTCA
ATTACTGCCAGTTGGGGTTCAGTATATCTGCCAATGGGCTCGATTTATGTCGCCAAACGAAACTTTGAGCTGGCG
CAAATACAGCAGCTAATCACTCGTCGTTTTCTGGTGTGCTATAAAGTGCCCTAG
Gene >OphauB2|1566
ATGCCCCCTACGAGGCAGCAAAACCCTCAATTCGCCAAGGACGAGAAGGTTCTGTGCTTCCACATGGACATGCTT
TACGAAGCCAAGATTATGGAAGTGCAGTCAGGCGATAAGCCAGGTGATGGCTTCCGCTACAAGGTTCACTATAAG
GGTTGGAAAAATACCTGGGACGACTGGGTCCTGGCCGACCGCATACGCGCCTTTGACGACGAGCACAAGGAGCTA
GCGGCACAGCTTCATGCCCAGCTCAAGCAAAGCATGAGTAAGAGCTCTAAGCAGCCCAAAAGAGGCATCAAGGCC
GGTGCCGATTCAGCACGCGGCAGTGAGGAGCGAACTTCGACTTCTCTTCAAGGCGCGCGAGGCGGACGTCGAACC
AAGGACTGGGAACTCGAACAGGTTGGTGGCTTTGTCAAGCTTTTTCTTACTCGTGTTTGGTCCTTGTTGTACCGC
CATGTGCCTTTGCCCCTTGCCCACTTCAAGTTGTTGACCAACGGCACGCTTGTCAAGTGCGAGACTGCCCGTTTC
AAGAGTTTATCTCCCCTCCATGCACAGACCACACATCACCTTTACTCGCTTGGCTGCAGCCTCATAACCGATTCA
ATTACTGCCAGTTGGGGTTCAGTATATCTGCCAATGGGCTCGATTTATGTCGCCAAACGAAACTTTGAGCTGGCG
CAAATACAGCAGCTAATCACTCGTCGTTTTCTGGTGTGCTATAAAGTGCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail