Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1541
Gene name
LocationContig_140:23451..28984
Strand-
Gene length (bp)5533
Transcript length (bp)4707
Coding sequence length (bp)4707
Protein length (aa) 1569

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16879 Sin3a_C C-terminal domain of Sin3a protein 3.4E-70 1227 1499
PF02671 PAH Paired amphipathic helix repeat 9.8E-18 347 391
PF02671 PAH Paired amphipathic helix repeat 2.0E-17 560 604
PF08295 Sin3_corepress Sin3 family co-repressor 1.3E-39 818 909

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09750|PST1_SCHPO Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst1 PE=1 SV=1 328 1499 0.0E+00
sp|P22579|SIN3_YEAST Transcriptional regulatory protein SIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIN3 PE=1 SV=2 328 1098 4.0E-177
sp|Q60520|SIN3A_MOUSE Paired amphipathic helix protein Sin3a OS=Mus musculus GN=Sin3a PE=1 SV=3 498 1028 2.0E-85
sp|Q62141|SIN3B_MOUSE Paired amphipathic helix protein Sin3b OS=Mus musculus GN=Sin3b PE=1 SV=2 539 1117 2.0E-76
sp|Q96ST3|SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens GN=SIN3A PE=1 SV=2 498 1028 1.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09750|PST1_SCHPO Paired amphipathic helix protein pst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst1 PE=1 SV=1 328 1499 0.0E+00
sp|P22579|SIN3_YEAST Transcriptional regulatory protein SIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIN3 PE=1 SV=2 328 1098 4.0E-177
sp|Q60520|SIN3A_MOUSE Paired amphipathic helix protein Sin3a OS=Mus musculus GN=Sin3a PE=1 SV=3 498 1028 2.0E-85
sp|Q62141|SIN3B_MOUSE Paired amphipathic helix protein Sin3b OS=Mus musculus GN=Sin3b PE=1 SV=2 539 1117 2.0E-76
sp|Q96ST3|SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens GN=SIN3A PE=1 SV=2 498 1028 1.0E-75
sp|O75182|SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens GN=SIN3B PE=1 SV=2 539 1087 2.0E-71
sp|O13919|PST2_SCHPO Paired amphipathic helix protein pst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst2 PE=1 SV=1 546 1500 4.0E-71
sp|O74755|PST3_SCHPO Paired amphipathic helix protein pst3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst3 PE=3 SV=1 530 1456 4.0E-67
sp|O04539|SNL4_ARATH Paired amphipathic helix protein Sin3-like 4 OS=Arabidopsis thaliana GN=SNL4 PE=3 SV=3 536 1057 3.0E-49
sp|Q9LFQ3|SNL2_ARATH Paired amphipathic helix protein Sin3-like 2 OS=Arabidopsis thaliana GN=SNL2 PE=1 SV=2 536 1143 4.0E-47
sp|Q9SRH9|SNL1_ARATH Paired amphipathic helix protein Sin3-like 1 OS=Arabidopsis thaliana GN=SNL1 PE=1 SV=2 726 1024 5.0E-32
sp|O48686|SNL3_ARATH Paired amphipathic helix protein Sin3-like 3 OS=Arabidopsis thaliana GN=SNL3 PE=1 SV=3 804 1089 1.0E-30
sp|Q96ST3|SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens GN=SIN3A PE=1 SV=2 247 415 8.0E-30
sp|Q60520|SIN3A_MOUSE Paired amphipathic helix protein Sin3a OS=Mus musculus GN=Sin3a PE=1 SV=3 247 415 1.0E-29
sp|Q9XIE1|SNL5_ARATH Paired amphipathic helix protein Sin3-like 5 OS=Arabidopsis thaliana GN=SNL5 PE=2 SV=3 792 1060 5.0E-29
sp|Q9XIK6|SNL6_ARATH Paired amphipathic helix protein Sin3-like 6 OS=Arabidopsis thaliana GN=SNL6 PE=3 SV=2 806 1060 1.0E-27
sp|O74755|PST3_SCHPO Paired amphipathic helix protein pst3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst3 PE=3 SV=1 318 416 1.0E-24
sp|Q62141|SIN3B_MOUSE Paired amphipathic helix protein Sin3b OS=Mus musculus GN=Sin3b PE=1 SV=2 328 398 5.0E-22
sp|O75182|SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens GN=SIN3B PE=1 SV=2 328 398 6.0E-22
sp|Q9SRH9|SNL1_ARATH Paired amphipathic helix protein Sin3-like 1 OS=Arabidopsis thaliana GN=SNL1 PE=1 SV=2 324 407 1.0E-20
sp|Q9LFQ3|SNL2_ARATH Paired amphipathic helix protein Sin3-like 2 OS=Arabidopsis thaliana GN=SNL2 PE=1 SV=2 324 397 3.0E-20
sp|O48686|SNL3_ARATH Paired amphipathic helix protein Sin3-like 3 OS=Arabidopsis thaliana GN=SNL3 PE=1 SV=3 539 790 3.0E-20
sp|O48686|SNL3_ARATH Paired amphipathic helix protein Sin3-like 3 OS=Arabidopsis thaliana GN=SNL3 PE=1 SV=3 316 397 3.0E-18
sp|O04539|SNL4_ARATH Paired amphipathic helix protein Sin3-like 4 OS=Arabidopsis thaliana GN=SNL4 PE=3 SV=3 319 404 6.0E-18
sp|Q9XIE1|SNL5_ARATH Paired amphipathic helix protein Sin3-like 5 OS=Arabidopsis thaliana GN=SNL5 PE=2 SV=3 330 397 3.0E-17
sp|Q9XIK6|SNL6_ARATH Paired amphipathic helix protein Sin3-like 6 OS=Arabidopsis thaliana GN=SNL6 PE=3 SV=2 330 397 6.0E-17
sp|Q9SRH9|SNL1_ARATH Paired amphipathic helix protein Sin3-like 1 OS=Arabidopsis thaliana GN=SNL1 PE=1 SV=2 536 605 2.0E-13
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 318 397 1.0E-12
sp|Q9XIE1|SNL5_ARATH Paired amphipathic helix protein Sin3-like 5 OS=Arabidopsis thaliana GN=SNL5 PE=2 SV=3 536 669 5.0E-12
sp|Q9XIK6|SNL6_ARATH Paired amphipathic helix protein Sin3-like 6 OS=Arabidopsis thaliana GN=SNL6 PE=3 SV=2 539 618 5.0E-12
sp|O74755|PST3_SCHPO Paired amphipathic helix protein pst3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pst3 PE=3 SV=1 511 668 2.0E-09
sp|O75182|SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens GN=SIN3B PE=1 SV=2 1227 1456 4.0E-06
sp|P22579|SIN3_YEAST Transcriptional regulatory protein SIN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIN3 PE=1 SV=2 538 606 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0065007 biological regulation No
GO:2001141 regulation of RNA biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0080090 regulation of primary metabolic process No
GO:0050794 regulation of cellular process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0019222 regulation of metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0031323 regulation of cellular metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1541
MAGFGAQASSDLVTVFAERGARSSGSKLSFEAHQNFVMNTSGLHGRGPYDREREMEDRHRAMQQQQQQHDDMRRD
QARERERDRERERETGEQYQATPHQSNAGSITIHQPVASRVPGAIHSPGGLLANHNGGPAAHMGGPPGSMVSFGG
PLQGEHGRPMQQHAGQQAAGAGQSHQIFPPMTHGQSQGGPQGASTGASAVYVPSSSQQHGPPPPPQQQQQQQQQQ
QQQQQPQQQQQQQHPHPPPMQQQQTAPQQASQPQHQTHAQPAPSRQQPQAQPPQPQQAPPQQSQQQPPEAQRSGG
KQSGPIVGVTPGGHQIPGGITQGQQPILNDALTYLDQVKVQFHDQPDVYNRFLDIMKDFKSQAIDTPGVISRVSD
LFVGHPNLIQGFNTFLPPGYRIECGGGDDNDPNTIRVTTPMGTTVQSISGRGGPAPAAHGPSSVAPQGPFAERGG
QWQQRPQHSVESPESKFMTPALNGANLFVQAAAHNALYEQRNAAQMQPPTASASSVPARSGQTPVSAAGPGAVNG
SGGGAASLERRGPVEFNHAISYVNKIKNRFQDKPDIYKQFLEILQTYQREQKPIQDVYAQVTTLFNSAPDLLEDF
KQFLPETAGQAKATPGRIDEGIPSGPSHTPQPGPRDGHKMPPLGSFAPPPSASKDKKRPRNDKQALIADAYSGDT
PAAGRLHQAVNGNKRPKLSHSRVTGDAAVSAIAPTLTPVMPEPYPPQSPYSSTQEELAFFERVKKYLGNRSTMNE
FLKICNLFTQNIIDRNMLFHKGAVFISANPDLLSFWKSFVGVGSHDVMIENRPAPPTEKVSLSNCRGYGPSYRLL
PKRERLKPCSGRDELCNSVLNDEWASHPTWASEDSGFVAHRKNQFEEALHRIEEERHDYDFYIEINLKCIQLLEP
IAQQMLAMTVPEREAFNLASALAGQSTSIFRRLCKKIYGERGIDVVNDLYRAPFGVVPILLARMKQKDEEWRFSQ
REWEKVWHVQTEHIYLKSLDHMGILVKANDKRNLTAKHLVDVIKTKHEEQRRQRCLVGSAPRHQFVWDFGDKDVI
IDLLRLMMLFPLHSGQHSVQEKERLSEFFESFVTSFFDISDEAVQDRMPRIPPDSAEEEMEDSTPAELTNGRSRR
NGRKSDLLRGVLDPGRNGSSKPRSQKEDSAASGSKETTPDVASANEEEMPDAVDDAAGTDVSNERWMPTVPKPTV
VGGDNSLLDAEGELKADGFFRRPWYNFFANQTIYIFFSIFQTVYSRLVELKGSKDLVGDEIERLIRPKPARDIGF
AEVVPVHFQAEEDSSKYWPKTLELIEEYITGDIDEARYQEVLRRYYLRNGWKLYTIQDQLKTLCRLALVCSSNDA
KEKTPDLIHQYFASREKEETSYQTEISARKFAEKCVKDGDIFVICWFPDKAEATIRWLQRNDTTFYMDEMQMRER
WQYYISSFIRVEPTEGIARSKMQKVVLARNLPSGDGDSDDERTPKPLSYSEELHTSICVKSSKMLWGPGTSEYFV
YDKTPKSAESRAAQIKAREAFTGLREQRVHERVDKPAWAKDEDEVRARDEWWSRWRDEGVLAVGNGDV*
Coding >OphauB2|1541
ATGGCTGGATTTGGCGCGCAAGCATCATCAGATCTCGTCACCGTCTTTGCCGAAAGGGGAGCAAGATCAAGTGGC
AGCAAACTGAGCTTTGAAGCCCATCAAAACTTCGTCATGAATACTTCAGGCCTTCATGGTCGAGGGCCCTACGAT
CGCGAGCGTGAGATGGAGGATCGTCATCGCGCCATGCAGCAGCAGCAGCAGCAGCACGACGACATGCGCCGTGAC
CAGGCGCGCGAGCGCGAGCGAGATAGGGAGCGGGAGCGCGAGACGGGGGAGCAATACCAGGCGACGCCTCATCAG
AGCAATGCAGGGTCCATCACGATACACCAGCCAGTCGCTTCGCGGGTCCCGGGCGCGATTCATAGTCCTGGAGGA
CTGCTAGCCAACCATAATGGCGGCCCAGCGGCACACATGGGCGGACCTCCGGGTTCCATGGTGAGCTTTGGCGGC
CCTTTGCAGGGCGAACATGGCCGGCCGATGCAGCAGCACGCAGGCCAGCAGGCGGCCGGCGCTGGGCAGTCGCAC
CAGATATTCCCGCCCATGACGCATGGGCAGAGCCAGGGCGGGCCTCAGGGCGCGTCGACTGGTGCTTCTGCCGTG
TATGTTCCGTCGTCGTCGCAGCAGCATGGTCCGCCGCCGCCGCCACAGCAGCAGCAGCAACAGCAGCAGCAACAG
CAACAGCAACAGCAACCACAGCAGCAGCAGCAGCAGCAGCATCCCCATCCGCCGCCAATGCAGCAGCAACAGACA
GCGCCACAGCAAGCATCACAGCCGCAGCATCAAACGCATGCCCAGCCGGCTCCTTCTCGCCAGCAGCCCCAAGCT
CAACCTCCACAGCCACAGCAAGCGCCACCCCAGCAGTCGCAGCAACAACCACCAGAGGCCCAGCGCAGTGGCGGC
AAGCAGAGCGGGCCCATTGTCGGCGTCACTCCTGGCGGTCACCAGATCCCAGGGGGCATAACACAGGGCCAGCAG
CCTATTCTCAATGACGCCCTTACGTACCTAGATCAGGTCAAGGTGCAATTCCATGACCAACCAGATGTCTATAAT
CGCTTTCTTGACATCATGAAGGACTTCAAGAGCCAAGCTATCGATACCCCTGGAGTCATTAGCCGCGTCTCAGAT
CTTTTCGTCGGCCATCCCAATCTGATTCAAGGCTTCAACACGTTTCTTCCTCCGGGCTATAGAATTGAGTGCGGC
GGTGGCGACGACAACGACCCCAATACGATTCGGGTAACGACTCCCATGGGCACGACGGTGCAGTCGATTAGTGGA
CGCGGCGGCCCAGCGCCTGCGGCTCATGGGCCGTCGTCGGTGGCACCCCAAGGCCCATTTGCTGAGCGCGGCGGC
CAGTGGCAGCAGCGGCCACAGCACAGTGTAGAAAGCCCAGAGTCCAAGTTTATGACTCCAGCGCTCAACGGCGCC
AATCTCTTTGTACAGGCAGCTGCACACAATGCGCTTTACGAGCAACGAAACGCGGCCCAGATGCAGCCTCCAACG
GCTTCGGCGAGCAGTGTGCCAGCGCGTAGCGGGCAGACGCCTGTTTCTGCTGCGGGCCCTGGCGCTGTCAATGGA
AGCGGTGGCGGTGCGGCAAGCCTAGAGCGTCGCGGACCGGTTGAGTTTAACCACGCTATAAGCTACGTCAATAAG
ATTAAGAACCGTTTCCAGGATAAACCAGACATATATAAGCAATTCCTAGAAATATTACAGACGTACCAACGAGAA
CAAAAACCGATACAAGACGTCTACGCCCAAGTGACGACGCTCTTCAACTCGGCACCCGATCTTCTTGAAGACTTT
AAGCAATTTTTGCCCGAAACAGCTGGCCAGGCCAAGGCGACGCCTGGGCGAATTGACGAGGGCATTCCGTCGGGC
CCTAGCCACACGCCTCAGCCGGGGCCTCGAGACGGACACAAGATGCCTCCTCTTGGAAGCTTTGCCCCGCCCCCG
AGCGCGAGCAAGGACAAGAAGAGGCCTCGCAACGATAAGCAAGCTCTTATTGCCGACGCGTATTCTGGCGACACG
CCTGCGGCTGGGCGACTCCATCAAGCTGTCAATGGAAATAAGCGCCCCAAGCTCAGCCATAGTCGAGTCACGGGC
GATGCGGCCGTCTCTGCCATTGCACCGACACTGACTCCTGTCATGCCCGAGCCGTATCCCCCACAGTCGCCCTAT
TCGTCCACGCAGGAAGAGTTGGCCTTTTTTGAACGCGTCAAGAAGTATCTTGGCAACCGGTCGACAATGAATGAG
TTTCTCAAGATTTGCAACTTGTTTACGCAAAACATTATTGATCGCAACATGCTTTTCCACAAGGGAGCCGTGTTT
ATTAGTGCCAATCCGGATCTGCTGAGTTTCTGGAAATCCTTTGTCGGTGTAGGCTCTCACGACGTCATGATTGAG
AACCGCCCGGCGCCACCGACTGAAAAAGTGTCGCTGAGCAACTGCCGCGGCTATGGACCCAGTTACCGGCTTTTG
CCCAAGCGCGAACGCCTCAAGCCATGCAGCGGCCGCGACGAGCTATGCAACTCGGTTCTAAATGACGAGTGGGCG
TCACATCCTACATGGGCTAGCGAAGATTCAGGATTTGTCGCCCATCGCAAGAACCAGTTTGAGGAAGCTTTGCAC
AGGATTGAGGAAGAGCGCCATGACTATGATTTTTACATTGAAATCAATCTCAAGTGCATTCAGCTTCTTGAACCC
ATTGCACAACAAATGCTAGCCATGACGGTGCCAGAGCGAGAGGCATTTAATCTGGCCAGCGCTCTGGCCGGCCAA
AGCACCTCCATCTTTCGAAGACTATGCAAGAAGATATACGGAGAGAGGGGCATCGATGTTGTCAATGACTTGTAT
CGAGCCCCCTTTGGCGTGGTGCCGATTCTCTTGGCTCGCATGAAGCAAAAAGACGAGGAATGGCGATTTTCGCAG
CGCGAATGGGAAAAGGTGTGGCATGTACAGACGGAGCACATTTACCTCAAGAGCCTGGACCACATGGGCATTCTG
GTCAAGGCCAATGACAAGCGCAACCTGACGGCCAAGCACCTAGTCGACGTGATTAAGACCAAGCATGAGGAGCAG
CGTCGCCAACGGTGCCTGGTGGGAAGCGCCCCACGCCACCAGTTTGTGTGGGACTTTGGTGACAAGGACGTCATT
ATTGACTTGTTAAGACTCATGATGCTCTTCCCGCTACACAGCGGCCAACACAGTGTCCAGGAAAAGGAGAGGCTA
TCCGAGTTTTTTGAGTCGTTTGTCACGTCCTTTTTCGATATTAGCGACGAAGCTGTACAGGACAGGATGCCCCGA
ATCCCTCCCGACTCGGCTGAGGAAGAGATGGAAGACTCGACGCCCGCCGAGCTCACCAATGGCCGCAGCAGGCGC
AACGGCCGGAAGAGTGATCTTCTTCGCGGAGTGCTGGACCCTGGCCGCAACGGCAGCAGCAAGCCGCGTAGCCAA
AAGGAAGACAGTGCAGCTTCGGGCAGCAAGGAAACGACACCCGATGTGGCCTCGGCCAACGAGGAGGAGATGCCC
GACGCCGTTGATGATGCTGCAGGCACTGATGTTTCCAATGAGCGCTGGATGCCAACTGTCCCCAAGCCAACCGTG
GTGGGCGGCGACAACTCGCTCCTCGACGCCGAGGGAGAGCTCAAGGCTGATGGGTTTTTCCGGCGGCCCTGGTAC
AACTTTTTTGCAAACCAAACCATTTATATCTTTTTTAGCATCTTCCAGACCGTCTACAGCCGGTTGGTAGAGCTC
AAGGGAAGCAAAGACTTGGTGGGTGACGAGATTGAGAGGCTGATTCGGCCCAAGCCCGCTCGCGACATTGGCTTT
GCCGAAGTGGTGCCCGTGCATTTCCAGGCTGAAGAGGACAGTAGCAAGTATTGGCCCAAGACTTTGGAGCTGATT
GAGGAATACATCACGGGGGACATTGACGAGGCGCGGTATCAGGAAGTGCTGCGCCGCTACTACCTTCGCAACGGG
TGGAAGCTGTATACGATTCAAGACCAGCTCAAGACACTGTGTCGCCTGGCGCTCGTGTGCAGCAGCAACGATGCC
AAGGAGAAGACGCCCGACTTGATTCACCAATACTTTGCCAGCCGAGAAAAGGAAGAGACGAGCTACCAGACTGAA
ATCAGCGCTCGCAAATTTGCCGAAAAGTGTGTCAAGGATGGAGACATTTTTGTCATTTGCTGGTTTCCCGACAAG
GCTGAAGCGACGATACGCTGGCTACAGCGCAACGATACGACGTTTTATATGGACGAGATGCAGATGCGGGAGCGG
TGGCAGTACTACATTTCGTCCTTTATCCGCGTGGAGCCAACCGAGGGCATTGCGCGGTCCAAGATGCAAAAAGTC
GTGCTGGCGCGCAACTTGCCCTCTGGAGACGGCGACTCTGACGACGAGCGCACGCCAAAGCCCCTGTCGTATAGC
GAAGAGCTACACACGAGCATTTGCGTAAAGAGCTCCAAGATGTTGTGGGGCCCCGGAACGAGCGAGTACTTTGTC
TACGACAAGACGCCCAAGTCTGCCGAGAGCAGGGCGGCGCAGATAAAGGCTCGCGAGGCGTTTACGGGACTGAGG
GAGCAGAGGGTCCACGAGCGAGTCGACAAGCCGGCATGGGCAAAGGACGAGGATGAGGTGCGGGCAAGGGATGAG
TGGTGGTCTAGGTGGAGGGATGAGGGTGTTTTGGCGGTGGGAAATGGTGATGTGTGA
Transcript >OphauB2|1541
ATGGCTGGATTTGGCGCGCAAGCATCATCAGATCTCGTCACCGTCTTTGCCGAAAGGGGAGCAAGATCAAGTGGC
AGCAAACTGAGCTTTGAAGCCCATCAAAACTTCGTCATGAATACTTCAGGCCTTCATGGTCGAGGGCCCTACGAT
CGCGAGCGTGAGATGGAGGATCGTCATCGCGCCATGCAGCAGCAGCAGCAGCAGCACGACGACATGCGCCGTGAC
CAGGCGCGCGAGCGCGAGCGAGATAGGGAGCGGGAGCGCGAGACGGGGGAGCAATACCAGGCGACGCCTCATCAG
AGCAATGCAGGGTCCATCACGATACACCAGCCAGTCGCTTCGCGGGTCCCGGGCGCGATTCATAGTCCTGGAGGA
CTGCTAGCCAACCATAATGGCGGCCCAGCGGCACACATGGGCGGACCTCCGGGTTCCATGGTGAGCTTTGGCGGC
CCTTTGCAGGGCGAACATGGCCGGCCGATGCAGCAGCACGCAGGCCAGCAGGCGGCCGGCGCTGGGCAGTCGCAC
CAGATATTCCCGCCCATGACGCATGGGCAGAGCCAGGGCGGGCCTCAGGGCGCGTCGACTGGTGCTTCTGCCGTG
TATGTTCCGTCGTCGTCGCAGCAGCATGGTCCGCCGCCGCCGCCACAGCAGCAGCAGCAACAGCAGCAGCAACAG
CAACAGCAACAGCAACCACAGCAGCAGCAGCAGCAGCAGCATCCCCATCCGCCGCCAATGCAGCAGCAACAGACA
GCGCCACAGCAAGCATCACAGCCGCAGCATCAAACGCATGCCCAGCCGGCTCCTTCTCGCCAGCAGCCCCAAGCT
CAACCTCCACAGCCACAGCAAGCGCCACCCCAGCAGTCGCAGCAACAACCACCAGAGGCCCAGCGCAGTGGCGGC
AAGCAGAGCGGGCCCATTGTCGGCGTCACTCCTGGCGGTCACCAGATCCCAGGGGGCATAACACAGGGCCAGCAG
CCTATTCTCAATGACGCCCTTACGTACCTAGATCAGGTCAAGGTGCAATTCCATGACCAACCAGATGTCTATAAT
CGCTTTCTTGACATCATGAAGGACTTCAAGAGCCAAGCTATCGATACCCCTGGAGTCATTAGCCGCGTCTCAGAT
CTTTTCGTCGGCCATCCCAATCTGATTCAAGGCTTCAACACGTTTCTTCCTCCGGGCTATAGAATTGAGTGCGGC
GGTGGCGACGACAACGACCCCAATACGATTCGGGTAACGACTCCCATGGGCACGACGGTGCAGTCGATTAGTGGA
CGCGGCGGCCCAGCGCCTGCGGCTCATGGGCCGTCGTCGGTGGCACCCCAAGGCCCATTTGCTGAGCGCGGCGGC
CAGTGGCAGCAGCGGCCACAGCACAGTGTAGAAAGCCCAGAGTCCAAGTTTATGACTCCAGCGCTCAACGGCGCC
AATCTCTTTGTACAGGCAGCTGCACACAATGCGCTTTACGAGCAACGAAACGCGGCCCAGATGCAGCCTCCAACG
GCTTCGGCGAGCAGTGTGCCAGCGCGTAGCGGGCAGACGCCTGTTTCTGCTGCGGGCCCTGGCGCTGTCAATGGA
AGCGGTGGCGGTGCGGCAAGCCTAGAGCGTCGCGGACCGGTTGAGTTTAACCACGCTATAAGCTACGTCAATAAG
ATTAAGAACCGTTTCCAGGATAAACCAGACATATATAAGCAATTCCTAGAAATATTACAGACGTACCAACGAGAA
CAAAAACCGATACAAGACGTCTACGCCCAAGTGACGACGCTCTTCAACTCGGCACCCGATCTTCTTGAAGACTTT
AAGCAATTTTTGCCCGAAACAGCTGGCCAGGCCAAGGCGACGCCTGGGCGAATTGACGAGGGCATTCCGTCGGGC
CCTAGCCACACGCCTCAGCCGGGGCCTCGAGACGGACACAAGATGCCTCCTCTTGGAAGCTTTGCCCCGCCCCCG
AGCGCGAGCAAGGACAAGAAGAGGCCTCGCAACGATAAGCAAGCTCTTATTGCCGACGCGTATTCTGGCGACACG
CCTGCGGCTGGGCGACTCCATCAAGCTGTCAATGGAAATAAGCGCCCCAAGCTCAGCCATAGTCGAGTCACGGGC
GATGCGGCCGTCTCTGCCATTGCACCGACACTGACTCCTGTCATGCCCGAGCCGTATCCCCCACAGTCGCCCTAT
TCGTCCACGCAGGAAGAGTTGGCCTTTTTTGAACGCGTCAAGAAGTATCTTGGCAACCGGTCGACAATGAATGAG
TTTCTCAAGATTTGCAACTTGTTTACGCAAAACATTATTGATCGCAACATGCTTTTCCACAAGGGAGCCGTGTTT
ATTAGTGCCAATCCGGATCTGCTGAGTTTCTGGAAATCCTTTGTCGGTGTAGGCTCTCACGACGTCATGATTGAG
AACCGCCCGGCGCCACCGACTGAAAAAGTGTCGCTGAGCAACTGCCGCGGCTATGGACCCAGTTACCGGCTTTTG
CCCAAGCGCGAACGCCTCAAGCCATGCAGCGGCCGCGACGAGCTATGCAACTCGGTTCTAAATGACGAGTGGGCG
TCACATCCTACATGGGCTAGCGAAGATTCAGGATTTGTCGCCCATCGCAAGAACCAGTTTGAGGAAGCTTTGCAC
AGGATTGAGGAAGAGCGCCATGACTATGATTTTTACATTGAAATCAATCTCAAGTGCATTCAGCTTCTTGAACCC
ATTGCACAACAAATGCTAGCCATGACGGTGCCAGAGCGAGAGGCATTTAATCTGGCCAGCGCTCTGGCCGGCCAA
AGCACCTCCATCTTTCGAAGACTATGCAAGAAGATATACGGAGAGAGGGGCATCGATGTTGTCAATGACTTGTAT
CGAGCCCCCTTTGGCGTGGTGCCGATTCTCTTGGCTCGCATGAAGCAAAAAGACGAGGAATGGCGATTTTCGCAG
CGCGAATGGGAAAAGGTGTGGCATGTACAGACGGAGCACATTTACCTCAAGAGCCTGGACCACATGGGCATTCTG
GTCAAGGCCAATGACAAGCGCAACCTGACGGCCAAGCACCTAGTCGACGTGATTAAGACCAAGCATGAGGAGCAG
CGTCGCCAACGGTGCCTGGTGGGAAGCGCCCCACGCCACCAGTTTGTGTGGGACTTTGGTGACAAGGACGTCATT
ATTGACTTGTTAAGACTCATGATGCTCTTCCCGCTACACAGCGGCCAACACAGTGTCCAGGAAAAGGAGAGGCTA
TCCGAGTTTTTTGAGTCGTTTGTCACGTCCTTTTTCGATATTAGCGACGAAGCTGTACAGGACAGGATGCCCCGA
ATCCCTCCCGACTCGGCTGAGGAAGAGATGGAAGACTCGACGCCCGCCGAGCTCACCAATGGCCGCAGCAGGCGC
AACGGCCGGAAGAGTGATCTTCTTCGCGGAGTGCTGGACCCTGGCCGCAACGGCAGCAGCAAGCCGCGTAGCCAA
AAGGAAGACAGTGCAGCTTCGGGCAGCAAGGAAACGACACCCGATGTGGCCTCGGCCAACGAGGAGGAGATGCCC
GACGCCGTTGATGATGCTGCAGGCACTGATGTTTCCAATGAGCGCTGGATGCCAACTGTCCCCAAGCCAACCGTG
GTGGGCGGCGACAACTCGCTCCTCGACGCCGAGGGAGAGCTCAAGGCTGATGGGTTTTTCCGGCGGCCCTGGTAC
AACTTTTTTGCAAACCAAACCATTTATATCTTTTTTAGCATCTTCCAGACCGTCTACAGCCGGTTGGTAGAGCTC
AAGGGAAGCAAAGACTTGGTGGGTGACGAGATTGAGAGGCTGATTCGGCCCAAGCCCGCTCGCGACATTGGCTTT
GCCGAAGTGGTGCCCGTGCATTTCCAGGCTGAAGAGGACAGTAGCAAGTATTGGCCCAAGACTTTGGAGCTGATT
GAGGAATACATCACGGGGGACATTGACGAGGCGCGGTATCAGGAAGTGCTGCGCCGCTACTACCTTCGCAACGGG
TGGAAGCTGTATACGATTCAAGACCAGCTCAAGACACTGTGTCGCCTGGCGCTCGTGTGCAGCAGCAACGATGCC
AAGGAGAAGACGCCCGACTTGATTCACCAATACTTTGCCAGCCGAGAAAAGGAAGAGACGAGCTACCAGACTGAA
ATCAGCGCTCGCAAATTTGCCGAAAAGTGTGTCAAGGATGGAGACATTTTTGTCATTTGCTGGTTTCCCGACAAG
GCTGAAGCGACGATACGCTGGCTACAGCGCAACGATACGACGTTTTATATGGACGAGATGCAGATGCGGGAGCGG
TGGCAGTACTACATTTCGTCCTTTATCCGCGTGGAGCCAACCGAGGGCATTGCGCGGTCCAAGATGCAAAAAGTC
GTGCTGGCGCGCAACTTGCCCTCTGGAGACGGCGACTCTGACGACGAGCGCACGCCAAAGCCCCTGTCGTATAGC
GAAGAGCTACACACGAGCATTTGCGTAAAGAGCTCCAAGATGTTGTGGGGCCCCGGAACGAGCGAGTACTTTGTC
TACGACAAGACGCCCAAGTCTGCCGAGAGCAGGGCGGCGCAGATAAAGGCTCGCGAGGCGTTTACGGGACTGAGG
GAGCAGAGGGTCCACGAGCGAGTCGACAAGCCGGCATGGGCAAAGGACGAGGATGAGGTGCGGGCAAGGGATGAG
TGGTGGTCTAGGTGGAGGGATGAGGGTGTTTTGGCGGTGGGAAATGGTGATGTGTGA
Gene >OphauB2|1541
ATGGCTGGATTTGGCGCGCAAGCATCATCAGATCTCGTCACCGTCTTTGCCGAAAGGGGAGCAAGATCAAGGTCT
TGCTCTCCACCACACTCTCTTGCAACGCCTGGTATTGGGCCTTGTCTGCAGGTTCAGCAAGTAGAGCCACGTCTT
GTGCCCATGGGAGGCTTGTCGTTACATGATTAATTTACCAGTGGCAGCAAACTGAGCTTTGAAGCCGTAAGTCCG
ACCTTCTTTTTTTTTTGACTTGGTCCTTTTTTTTTCCCACCCAAGGTCTGATTTTCTTCGCATCGGCACTCGTCA
CCAAGAGGCCACGGTACTGCCGGGTGCTTTTTGCTCATAGTTTGACAGCATCAAAACTTCGTCATGAATACTTCA
GGCCTTCATGGTCGAGGGCCCTACGATCGCGAGCGTGAGATGGAGGATCGTCATCGCGCCATGCAGCAGCAGCAG
CAGCAGCACGACGACATGCGCCGTGACCAGGCGCGCGAGCGCGAGCGAGATAGGGAGCGGGAGCGCGAGACGGGG
GAGCAATACCAGGCGACGCCTCATCAGAGCAATGCAGGGTCCATCACGATACACCAGCCAGTCGCTTCGCGGGTC
CCGGGCGCGATTCATAGTCCTGGAGGACTGCTAGCCAACCATAATGGCGGCCCAGCGGCACACATGGGCGGACCT
CCGGGTTCCATGGTGAGCTTTGGCGGCCCTTTGCAGGGCGAACATGGCCGGCCGATGCAGCAGCACGCAGGCCAG
CAGGCGGCCGGCGCTGGGCAGTCGCACCAGATATTCCCGCCCATGACGCATGGGCAGAGCCAGGGCGGGCCTCAG
GGCGCGTCGACTGGTGCTTCTGCCGTGTATGTTCCGTCGTCGTCGCAGCAGCATGGTCCGCCGCCGCCGCCACAG
CAGCAGCAGCAACAGCAGCAGCAACAGCAACAGCAACAGCAACCACAGCAGCAGCAGCAGCAGCAGCATCCCCAT
CCGCCGCCAATGCAGCAGCAACAGACAGCGCCACAGCAAGCATCACAGCCGCAGCATCAAACGCATGCCCAGCCG
GCTCCTTCTCGCCAGCAGCCCCAAGCTCAACCTCCACAGCCACAGCAAGCGCCACCCCAGCAGTCGCAGCAACAA
CCACCAGAGGCCCAGCGCAGTGGCGGCAAGCAGAGCGGGCCCATTGTCGGCGTCACTCCTGGCGGTCACCAGATC
CCAGGGGGCATAACACAGGGCCAGCAGCCTATTCTCAATGTAAGTGCCAGAAGCCTTTCCAAAAAAGGGTGGCAC
CAGATTGGTGGTGAAAGACGACTTGATTGGATGTACAATATGCTGCTGTTTTTATCGTCTTTTCCCACCGCCTGG
TTTGCACTATAAGTCTTTCCACATTTGCTCGCAGGCATTTGCCCATGAAGTTATCTTTTGCATTGCATCAAGCTC
TGTGTTTTCTTATTTTTTTTTAAGCCCGGAAAGCCGTTTTGTTACATCATGTCGCGTATCCGGTATCCTGGGATG
GAGAATCTGGTGCTGGCGGCCTACATGCGGGAATACCGGGATTTTACCAAAGTTGTGTTTTTTTTGTCACTTTTT
CCCTTGGCAAGGTTTCAACTAACATATTTATCTTGATAGGACGCCCTTACGTACCTAGATCAGGTCAAGGTGCAA
TTCCATGACCAACCAGATGTCTATAATCGCTTTCTTGACATCATGAAGGACTTCAAGAGCCAAGCGTGAGTACCA
GCTGCAACAACCTTGTACTTGACGGTAATCTCAAAAGGCGTTGTAGTATCGATACCCCTGGAGTCATTAGCCGCG
TCTCAGATCTTTTCGTCGGCCATCCCAATCTGATTCAAGGCTTCAACACGTTTCTTCCTCCGGGCTATAGAATTG
AGTGCGGCGGTGGCGACGACAACGACCCCAATACGATTCGGGTAACGACTCCCATGGGCACGACGGTGCAGTCGA
TTAGTGGACGCGGCGGCCCAGCGCCTGCGGCTCATGGGCCGTCGTCGGTGGCACCCCAAGGCCCATTTGCTGAGC
GCGGCGGCCAGTGGCAGCAGCGGCCACAGCACAGTGTAGAAAGCCCAGAGTCCAAGTTTATGACTCCAGCGCTCA
ACGGCGCCAATCTCTTTGTACAGGCAGCTGCACACAATGCGCTTTACGAGCAACGAAACGCGGCCCAGATGCAGC
CTCCAACGGCTTCGGCGAGCAGTGTGCCAGCGCGTAGCGGGCAGACGCCTGTTTCTGCTGCGGGCCCTGGCGCTG
TCAATGGAAGCGGTGGCGGTGCGGCAAGCCTAGAGCGTCGCGGACCGGTTGAGTTTAACCACGCTATAAGCTACG
TCAATAAGATTAAGGTGAGGGCATGGCGAGGCTGGTGGCTTGCGAGGTGCGTCTGCTGACTCATTCAACCTTGCA
GAACCGTTTCCAGGATAAACCAGACATATATAAGCAATTCCTAGAAATATTACAGACGTACCAACGAGAACAAAA
ACCGATACAAGACGTCTACGCCCAAGTGACGACGCTCTTCAACTCGGCACCCGATCTTCTTGAAGACTTTAAGCA
ATTTTTGCCCGAAACAGCTGGCCAGGCCAAGGCGACGCCTGGGCGAATTGACGAGGGCATTCCGTCGGGCCCTAG
CCACACGCCTCAGCCGGGGCCTCGAGACGGACACAAGATGCCTCCTCTTGGAAGCTTTGCCCCGCCCCCGAGCGC
GAGCAAGGACAAGAAGAGGCCTCGCAACGATAAGCAAGCTCTTATTGCCGACGCGTATTCTGGCGACACGCCTGC
GGCTGGGCGACTCCATCAAGCTGTCAATGGAAATAAGCGCCCCAAGCTCAGCCATAGTCGAGTCACGGGCGATGC
GGCCGTCTCTGCCATTGCACCGACACTGACTCCTGTCATGCCCGAGCCGTATCCCCCACAGTCGCCCTATTCGTC
CACGCAGGAAGAGTTGGCCTTTTTTGAACGCGTCAAGAAGTATCTTGGCAACCGGTCGACAATGAATGAGTTTCT
CAAGATTTGCAACTTGTTTACGCAAAACATTATTGATCGCAACATGCTTTTCCACAAGGGAGCCGTGTTTATTAG
TGCCAATCCGGATCTGCTGAGTTTCTGGAAATCCTTTGTCGGTGTAGGCTCTCACGACGTCATGATTGAGAACCG
CCCGGCGCCACCGACTGAAAAAGTGTCGCTGAGCAACTGCCGCGGCTATGGACCCAGTTACCGGCTTTTGCCCAA
GCGCGAACGCCTCAAGCCATGCAGCGGCCGCGACGAGCTATGCAACTCGGTTCTAAATGACGAGTGGGCGTCACA
TCCTACATGGGCTAGCGAAGATTCAGGATTTGTCGCCCATCGCAAGAACCAGTTTGAGGAAGCTTTGCACAGGAT
TGAGGAAGAGCGCCATGACTATGATTTTTACATTGAAATCAATCTCAAGTGCATTCAGCTTCTTGAACCCATTGC
ACAACAAATGCTAGCCATGACGGTGCCAGAGCGAGAGGCATTTAATCTGGCCAGCGCTCTGGCCGGCCAAAGCAC
CTCCATCTTTCGAAGACTATGCAAGAAGATATACGGAGAGAGGGGCATCGATGTTGTCAATGACTTGTATCGAGC
CCCCTTTGGCGTGGTGCCGATTCTCTTGGCTCGCATGAAGCAAAAAGACGAGGAATGGCGATTTTCGCAGCGCGA
ATGGGAAAAGGTGTGGCATGTACAGACGGAGCACATTTACCTCAAGAGCCTGGACCACATGGGCATTCTGGTCAA
GGCCAATGACAAGCGCAACCTGACGGCCAAGCACCTAGTCGACGTGATTAAGACCAAGCATGAGGAGCAGCGTCG
CCAACGGTGCCTGGTGGGAAGCGCCCCACGCCACCAGTTTGTGTGGGACTTTGGTGACAAGGACGTCATTATTGA
CTTGTTAAGACTCATGATGCTCTTCCCGCTACACAGCGGCCAACACAGTGTCCAGGAAAAGGAGAGGCTATCCGA
GTTTTTTGAGTCGTTTGTCACGTCCTTTTTCGATATTAGCGACGAAGCTGTACAGGACAGGATGCCCCGAATCCC
TCCCGACTCGGCTGAGGAAGAGATGGAAGACTCGACGCCCGCCGAGCTCACCAATGGCCGCAGCAGGCGCAACGG
CCGGAAGAGTGATCTTCTTCGCGGAGTGCTGGACCCTGGCCGCAACGGCAGCAGCAAGCCGCGTAGCCAAAAGGA
AGACAGTGCAGCTTCGGGCAGCAAGGAAACGACACCCGATGTGGCCTCGGCCAACGAGGAGGAGATGCCCGACGC
CGTTGATGATGCTGCAGGCACTGATGTTTCCAATGAGCGCTGGATGCCAACTGTCCCCAAGCCAACCGTGGTGGG
CGGCGACAACTCGCTCCTCGACGCCGAGGGAGAGCTCAAGGCTGATGGGTTTTTCCGGCGGCCCTGGTACAACTT
TTTTGCAAACCAAACCATTTATATCTTTTTTAGCATCTTCCAGACCGTCTACAGCCGGTTGGTAGAGCTCAAGGG
AAGCAAAGACTTGGTGGGTGACGAGATTGAGAGGCTGATTCGGCCCAAGCCCGCTCGCGACATTGGCTTTGCCGA
AGTGGTGCCCGTGCATTTCCAGGCTGAAGAGGACAGTAGCAAGTATTGGCCCAAGACTTTGGAGCTGATTGAGGA
ATACATCACGGGGGACATTGACGAGGCGCGGTATCAGGAAGTGCTGCGCCGCTACTACCTTCGCAACGGGTGGAA
GCTGTATACGATTCAAGACCAGCTCAAGACACTGTGTCGCCTGGCGCTCGTGTGCAGCAGCAACGATGCCAAGGA
GAAGACGCCCGACTTGATTCACCAATACTTTGCCAGCCGAGAAAAGGAAGAGACGAGCTACCAGACTGAAATCAG
CGCTCGCAAATTTGCCGAAAAGTGTGTCAAGGATGGAGACATTTTTGTCATTTGCTGGGTGAGTTTTTGCCCTTC
TACAGTTGCTCGACACGAAGCTTGATGGCTGACGCGCGATTTCTTTTTCTTTTTCCCTCAATAGTTTCCCGACAA
GGCTGAAGCGACGATACGCTGGCTACAGCGCAACGATACGACGTTTTATATGGACGAGATGCAGATGCGGGAGCG
GTGGCAGTACTACATTTCGTCCTTTATCCGCGTGGAGCCAACCGAGGGCATTGCGCGGTCCAAGATGCAAAAAGT
CGTGCTGGCGCGCAACTTGCCCTCTGGAGACGGCGACTCTGACGACGAGCGCACGCCAAAGCCCCTGTCGTATAG
CGAAGAGCTACACACGAGCATTTGCGTAAAGAGCTCCAAGATGTTGTGGGGCCCCGGAACGAGCGAGTACTTTGT
CTACGACAAGACGCCCAAGTCTGCCGAGAGCAGGGCGGCGCAGATAAAGGCTCGCGAGGCGTTTACGGGACTGAG
GGAGCAGAGGGTCCACGAGCGAGTCGACAAGCCGGCATGGGCAAAGGACGAGGATGAGGTGCGGGCAAGGGATGA
GTGGTGGTCTAGGTGGAGGGATGAGGGTGTTTTGGCGGTGGGAAATGGTGATGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail