Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1539
Gene name
LocationContig_140:15107..18294
Strand-
Gene length (bp)3187
Transcript length (bp)2949
Coding sequence length (bp)2949
Protein length (aa) 983

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.8E-45 129 446
PF16004 EFTUD2 116 kDa U5 small nuclear ribonucleoprotein component N-terminus 6.6E-34 2 111
PF03764 EFG_IV Elongation factor G, domain IV 1.4E-22 717 835
PF00679 EFG_C Elongation factor G C-terminus 1.2E-18 838 926
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 3.7E-09 501 575
PF14492 EFG_III Elongation Factor G, domain III 9.2E-07 595 660
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.4E-04 132 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 2 979 0.0E+00
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 3 966 0.0E+00
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 3 966 0.0E+00
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 3 966 0.0E+00
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 3 966 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94316|SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf10 PE=1 SV=2 2 979 0.0E+00
sp|Q5F3X4|U5S1_CHICK 116 kDa U5 small nuclear ribonucleoprotein component OS=Gallus gallus GN=EFTUD2 PE=2 SV=1 3 966 0.0E+00
sp|Q15029|U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 3 966 0.0E+00
sp|O08810|U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus GN=Eftud2 PE=1 SV=1 3 966 0.0E+00
sp|Q5R6E0|U5S1_PONAB 116 kDa U5 small nuclear ribonucleoprotein component OS=Pongo abelii GN=EFTUD2 PE=2 SV=1 3 966 0.0E+00
sp|A4FUD3|U5S1_BOVIN 116 kDa U5 small nuclear ribonucleoprotein component OS=Bos taurus GN=EFTUD2 PE=2 SV=1 3 966 0.0E+00
sp|Q90705|EF2_CHICK Elongation factor 2 OS=Gallus gallus GN=EEF2 PE=1 SV=3 123 966 0.0E+00
sp|Q5R8Z3|EF2_PONAB Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3 123 966 0.0E+00
sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4 123 966 0.0E+00
sp|P58252|EF2_MOUSE Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2 123 966 0.0E+00
sp|P05197|EF2_RAT Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4 123 966 0.0E+00
sp|A0SXL6|EF2_CALJA Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1 123 966 0.0E+00
sp|Q3SYU2|EF2_BOVIN Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3 123 966 0.0E+00
sp|Q23716|EF2_CRYPV Elongation factor 2 OS=Cryptosporidium parvum PE=3 SV=1 122 959 0.0E+00
sp|P09445|EF2_CRIGR Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=1 SV=4 123 966 0.0E+00
sp|Q96X45|EF2_NEUCR Elongation factor 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-3 PE=3 SV=3 123 959 0.0E+00
sp|P15112|EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum GN=efbA PE=1 SV=2 123 959 0.0E+00
sp|P13060|EF2_DROME Elongation factor 2 OS=Drosophila melanogaster GN=EF2 PE=1 SV=4 123 957 0.0E+00
sp|O14460|EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eft201 PE=1 SV=2 122 973 0.0E+00
sp|O23755|EF2_BETVU Elongation factor 2 OS=Beta vulgaris PE=2 SV=1 123 960 0.0E+00
sp|Q1HPK6|EF2_BOMMO Translation elongation factor 2 OS=Bombyx mori GN=tef2 PE=1 SV=1 123 957 0.0E+00
sp|P29691|EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans GN=eef-2 PE=2 SV=4 123 959 0.0E+00
sp|Q6BJ25|EF2_DEBHA Elongation factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EFT1 PE=3 SV=1 122 959 0.0E+00
sp|A5DI11|EF2_PICGU Elongation factor 2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFT2 PE=3 SV=1 120 959 0.0E+00
sp|Q754C8|EF2_ASHGO Elongation factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EFT1 PE=3 SV=1 123 959 0.0E+00
sp|P32324|EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFT1 PE=1 SV=1 120 959 0.0E+00
sp|Q875Z2|EF2_NAUCC Elongation factor 2 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=EFT1 PE=3 SV=1 120 959 0.0E+00
sp|Q874B9|EF2_PICPA Elongation factor 2 OS=Komagataella pastoris GN=EFT1 PE=3 SV=1 120 959 0.0E+00
sp|Q6CPQ9|EF2_KLULA Elongation factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EFT1 PE=3 SV=1 123 959 0.0E+00
sp|Q875S0|EF2_LACK1 Elongation factor 2 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=EFT2 PE=3 SV=1 123 959 0.0E+00
sp|P36048|SN114_YEAST Pre-mRNA-splicing factor SNU114 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNU114 PE=1 SV=1 2 979 0.0E+00
sp|C4YJQ8|EF2_CANAW Elongation factor 2 OS=Candida albicans (strain WO-1) GN=EFT2 PE=3 SV=1 123 973 0.0E+00
sp|Q5A0M4|EF2_CANAL Elongation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFT2 PE=1 SV=2 123 973 0.0E+00
sp|P28996|EF2_PARKE Elongation factor 2 OS=Parachlorella kessleri PE=2 SV=1 123 955 0.0E+00
sp|Q6FYA7|EF2_CANGA Elongation factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EFT1 PE=3 SV=1 120 959 0.0E+00
sp|Q06193|EF2_ENTHI Elongation factor 2 OS=Entamoeba histolytica GN=EF-2 PE=2 SV=1 120 959 0.0E+00
sp|Q17152|EF2_BLAHO Elongation factor 2 OS=Blastocystis hominis PE=2 SV=1 123 959 5.0E-154
sp|Q8SQT7|EF2_ENCCU Elongation factor 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=EFT1 PE=1 SV=1 115 930 3.0E-110
sp|O74945|RIA1_SCHPO Ribosome assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ria1 PE=3 SV=1 120 955 1.0E-98
sp|Q8ZZC1|EF2_PYRAE Elongation factor 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fusA PE=3 SV=1 127 966 1.0E-83
sp|Q9HM85|EF2_HALSA Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fusA PE=3 SV=2 123 955 2.0E-75
sp|B0R8C8|EF2_HALS3 Elongation factor 2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fusA PE=3 SV=1 123 955 2.0E-75
sp|Q5UZS7|EF2_HALMA Elongation factor 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fusA PE=3 SV=1 123 960 2.0E-72
sp|Q3IUM4|EF2_NATPD Elongation factor 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fusA PE=3 SV=1 123 917 3.0E-71
sp|C7NYH7|EF2_HALMD Elongation factor 2 OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=fusA PE=3 SV=1 123 905 8.0E-70
sp|Q58448|EF2_METJA Elongation factor 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fusA PE=3 SV=1 122 934 5.0E-69
sp|A0RW30|EF2_CENSY Elongation factor 2 OS=Cenarchaeum symbiosum (strain A) GN=fusA PE=3 SV=1 120 968 3.0E-66
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 439 959 6.0E-62
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 440 967 6.0E-61
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 440 955 1.0E-60
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 441 956 4.0E-58
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 432 966 4.0E-58
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 440 966 4.0E-58
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 439 965 2.0E-57
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 440 966 4.0E-57
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 440 959 3.0E-56
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 432 966 3.0E-56
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 441 956 1.0E-55
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 442 922 7.0E-54
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 418 965 2.0E-53
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 418 965 3.0E-53
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 418 965 3.0E-53
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 418 965 3.0E-53
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 418 965 3.0E-53
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 418 965 3.0E-53
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 418 965 3.0E-53
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 439 967 6.0E-53
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 441 959 7.0E-53
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 441 934 2.0E-52
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 439 965 2.0E-52
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 440 959 6.0E-52
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 440 956 6.0E-52
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 440 956 8.0E-52
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 439 967 4.0E-51
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 440 956 9.0E-51
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 120 500 3.0E-49
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 441 959 3.0E-49
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 441 959 6.0E-49
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 441 959 8.0E-49
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 441 959 2.0E-48
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 441 922 4.0E-48
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 441 922 4.0E-48
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 441 922 7.0E-48
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 440 934 7.0E-48
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 408 973 1.0E-47
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 120 493 1.0E-47
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 440 958 3.0E-47
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 441 922 3.0E-47
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 440 958 5.0E-47
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 441 922 9.0E-47
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 441 958 1.0E-46
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 439 954 3.0E-46
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 440 922 7.0E-46
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 440 958 7.0E-46
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 441 956 1.0E-45
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 441 958 1.0E-45
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 123 493 1.0E-45
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 442 959 2.0E-45
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 440 958 2.0E-45
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 441 955 4.0E-45
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 441 922 2.0E-44
sp|P53893|RIA1_YEAST Ribosome assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIA1 PE=1 SV=1 498 955 3.0E-44
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 440 956 5.0E-44
sp|Q7Z2Z2|ETUD1_HUMAN Elongation factor Tu GTP-binding domain-containing protein 1 OS=Homo sapiens GN=EFTUD1 PE=1 SV=2 491 955 8.0E-44
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 442 920 2.0E-43
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 420 961 8.0E-42
sp|A8ACA7|EF2_IGNH4 Elongation factor 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fusA PE=3 SV=1 120 330 4.0E-32
sp|O28385|EF2_ARCFU Elongation factor 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fusA PE=3 SV=1 122 335 2.0E-31
sp|Q975H5|EF2_SULTO Elongation factor 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fusA PE=3 SV=3 120 386 3.0E-31
sp|C3NED6|EF2_SULIY Elongation factor 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=fusA PE=3 SV=1 120 387 4.0E-31
sp|C3NHB6|EF2_SULIN Elongation factor 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=fusA PE=3 SV=1 120 387 4.0E-31
sp|C3MVH1|EF2_SULIM Elongation factor 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=fusA PE=3 SV=1 120 387 4.0E-31
sp|C3MQ53|EF2_SULIL Elongation factor 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=fusA PE=3 SV=1 120 387 4.0E-31
sp|C4KHE9|EF2_SULIK Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=fusA PE=3 SV=1 120 387 4.0E-31
sp|C3N5S0|EF2_SULIA Elongation factor 2 OS=Sulfolobus islandicus (strain M.16.27) GN=fusA PE=3 SV=1 120 387 4.0E-31
sp|P30925|EF2_SULSO Elongation factor 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fusA PE=1 SV=3 120 387 5.0E-31
sp|A3DMV6|EF2_STAMF Elongation factor 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fusA PE=3 SV=1 120 330 6.0E-31
sp|P61878|EF2_PYRWO Elongation factor 2 OS=Pyrococcus woesei GN=fusA PE=3 SV=1 122 330 7.0E-31
sp|P61877|EF2_PYRFU Elongation factor 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fusA PE=3 SV=1 122 330 7.0E-31
sp|O59521|EF2_PYRHO Elongation factor 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fusA PE=1 SV=2 122 330 7.0E-31
sp|A4YCV9|EF2_METS5 Elongation factor 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=fusA PE=3 SV=1 120 387 9.0E-31
sp|B1L7Q0|EF2_KORCO Elongation factor 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=fusA PE=3 SV=1 120 335 1.0E-30
sp|Q9V1Z8|EF2_PYRAB Elongation factor 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fusA PE=3 SV=1 122 330 1.0E-30
sp|Q74M52|EF2_NANEQ Elongation factor 2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fusA PE=3 SV=1 120 335 1.0E-30
sp|Q9YC19|EF2_AERPE Elongation factor 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fusA PE=3 SV=1 123 335 2.0E-30
sp|Q6L200|EF2_PICTO Elongation factor 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fusA PE=3 SV=1 121 333 3.0E-30
sp|B6YVG5|EF2_THEON Elongation factor 2 OS=Thermococcus onnurineus (strain NA1) GN=fusA PE=3 SV=1 122 330 3.0E-30
sp|C5A6N7|EF2_THEGJ Elongation factor 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fusA PE=3 SV=1 122 335 3.0E-30
sp|P23112|EF2_SULAC Elongation factor 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fusA PE=1 SV=3 120 386 7.0E-30
sp|Q5JFZ3|EF2_THEKO Elongation factor 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fusA PE=3 SV=1 122 335 2.0E-29
sp|B8D6B2|EF2_DESK1 Elongation factor 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=fusA PE=3 SV=1 114 330 4.0E-29
sp|Q979T3|EF2_THEVO Elongation factor 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fusA PE=3 SV=1 131 338 5.0E-29
sp|C6A4M0|EF2_THESM Elongation factor 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fusA PE=3 SV=1 122 335 1.0E-28
sp|P26752|EF2_THEAC Elongation factor 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fusA PE=3 SV=2 121 338 1.0E-28
sp|A5ULM6|EF2_METS3 Elongation factor 2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fusA PE=3 SV=1 122 349 2.0E-28
sp|O27131|EF2_METTH Elongation factor 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fusA PE=3 SV=2 122 351 3.0E-28
sp|P18667|EFG_SYNP6 Elongation factor G OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=fusA PE=3 SV=1 128 920 6.0E-28
sp|Q31PV4|EFG_SYNE7 Elongation factor G OS=Synechococcus elongatus (strain PCC 7942) GN=fusA PE=3 SV=1 128 920 6.0E-28
sp|A4WMR8|EF2_PYRAR Elongation factor 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fusA PE=3 SV=1 127 342 8.0E-28
sp|O93632|EF2_METBU Elongation factor 2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fusA PE=3 SV=1 123 338 2.0E-27
sp|A7I4X4|EF2_METB6 Elongation factor 2 OS=Methanoregula boonei (strain 6A8) GN=fusA PE=3 SV=1 120 359 4.0E-27
sp|A6UV44|EF2_META3 Elongation factor 2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fusA PE=3 SV=1 120 338 5.0E-27
sp|A3MSN3|EF2_PYRCJ Elongation factor 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fusA PE=3 SV=1 127 330 8.0E-27
sp|A1RVX2|EF2_PYRIL Elongation factor 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fusA PE=3 SV=1 127 330 1.0E-26
sp|Q7V501|EFG_PROMM Elongation factor G OS=Prochlorococcus marinus (strain MIT 9313) GN=fusA PE=3 SV=1 126 920 2.0E-26
sp|A2CC86|EFG_PROM3 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9303) GN=fusA PE=3 SV=1 126 920 2.0E-26
sp|B1YE08|EF2_PYRNV Elongation factor 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fusA PE=3 SV=1 127 330 3.0E-26
sp|Q0ID58|EFG_SYNS3 Elongation factor G OS=Synechococcus sp. (strain CC9311) GN=fusA PE=3 SV=1 125 920 4.0E-26
sp|P33159|EF2_DESMO Elongation factor 2 OS=Desulfurococcus mobilis GN=fusA PE=3 SV=1 114 330 5.0E-26
sp|Q6LXI2|EF2_METMP Elongation factor 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=fusA PE=3 SV=1 123 330 6.0E-26
sp|O93637|EF2_METMT Elongation factor 2 OS=Methanococcoides methylutens GN=fusA PE=3 SV=1 123 344 6.0E-26
sp|Q8TXJ4|EF2_METKA Elongation factor 2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fusA PE=3 SV=1 140 330 2.0E-25
sp|A4FWF0|EF2_METM5 Elongation factor 2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=fusA PE=3 SV=1 123 330 2.0E-25
sp|P09604|EF2_METVS Elongation factor 2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=fusA PE=3 SV=2 123 302 2.0E-25
sp|A9A9U4|EF2_METM6 Elongation factor 2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=fusA PE=3 SV=1 123 302 7.0E-25
sp|A6VGV5|EF2_METM7 Elongation factor 2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=fusA PE=3 SV=1 123 302 8.0E-25
sp|A5GIP1|EFG_SYNPW Elongation factor G OS=Synechococcus sp. (strain WH7803) GN=fusA PE=3 SV=1 126 920 3.0E-24
sp|O93640|EF2_METTE Elongation factor 2 OS=Methanosarcina thermophila GN=fusA PE=3 SV=1 123 351 5.0E-24
sp|D3E3N9|EF2_METRM Elongation factor 2 OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=fusA PE=3 SV=1 122 330 5.0E-24
sp|Q464Z3|EF2_METBF Elongation factor 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fusA PE=3 SV=1 123 387 2.0E-23
sp|Q7UZY6|EFG_PROMP Elongation factor G OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fusA PE=3 SV=1 125 920 2.0E-23
sp|Q3AW54|EFG_SYNS9 Elongation factor G OS=Synechococcus sp. (strain CC9902) GN=fusA PE=3 SV=1 126 920 4.0E-23
sp|A8G709|EFG_PROM2 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9215) GN=fusA PE=3 SV=1 125 920 7.0E-23
sp|Q8PUR7|EF2_METMA Elongation factor 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fusA PE=3 SV=1 123 338 8.0E-23
sp|Q8TRC3|EF2_METAC Elongation factor 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fusA PE=3 SV=1 123 387 1.0E-22
sp|A2BT84|EFG_PROMS Elongation factor G OS=Prochlorococcus marinus (strain AS9601) GN=fusA PE=3 SV=1 125 920 1.0E-22
sp|Q2NEL0|EF2_METST Elongation factor 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fusA PE=3 SV=1 122 338 3.0E-22
sp|Q318N4|EFG_PROM9 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9312) GN=fusA PE=3 SV=1 125 920 4.0E-22
sp|A3PEZ8|EFG_PROM0 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9301) GN=fusA PE=3 SV=1 125 920 6.0E-22
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 495 761 1.0E-21
sp|A3CXM8|EF2_METMJ Elongation factor 2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fusA PE=3 SV=1 122 349 3.0E-21
sp|B8GJK8|EF2_METPE Elongation factor 2 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fusA PE=3 SV=1 122 329 1.0E-20
sp|A0B7D5|EF2_METTP Elongation factor 2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fusA PE=3 SV=1 123 335 1.0E-20
sp|Q16BA3|LEPA_ROSDO Elongation factor 4 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=lepA PE=3 SV=1 129 297 2.0E-19
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 131 305 7.0E-19
sp|Q9X1V8|LEPA_THEMA Elongation factor 4 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lepA PE=3 SV=1 127 269 7.0E-19
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 131 305 8.0E-19
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 131 305 8.0E-19
sp|A6QLJ3|GUF1_BOVIN Translation factor GUF1, mitochondrial OS=Bos taurus GN=GUF1 PE=2 SV=1 75 269 1.0E-18
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 131 269 2.0E-18
sp|P60930|LEPA_BDEBA Elongation factor 4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lepA PE=3 SV=2 127 308 2.0E-18
sp|Q820H8|LEPA_NITEU Elongation factor 4 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lepA PE=3 SV=1 128 315 3.0E-18
sp|Q2Y873|LEPA_NITMU Elongation factor 4 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=lepA PE=3 SV=1 128 316 3.0E-18
sp|Q0SRD8|LEPA_CLOPS Elongation factor 4 OS=Clostridium perfringens (strain SM101 / Type A) GN=lepA PE=3 SV=1 124 269 3.0E-18
sp|Q8XIS6|LEPA_CLOPE Elongation factor 4 OS=Clostridium perfringens (strain 13 / Type A) GN=lepA PE=3 SV=1 124 269 3.0E-18
sp|Q0TNS2|LEPA_CLOP1 Elongation factor 4 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=lepA PE=3 SV=1 124 269 3.0E-18
sp|A6TSM4|LEPA_ALKMQ Elongation factor 4 OS=Alkaliphilus metalliredigens (strain QYMF) GN=lepA PE=3 SV=1 128 269 3.0E-18
sp|Q8NT19|EFG_CORGL Elongation factor G OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=fusA PE=3 SV=1 583 922 4.0E-18
sp|B0K3Y4|LEPA_THEPX Elongation factor 4 OS=Thermoanaerobacter sp. (strain X514) GN=lepA PE=3 SV=1 128 297 4.0E-18
sp|A8GRF6|LEPA_RICRS Elongation factor 4 OS=Rickettsia rickettsii (strain Sheila Smith) GN=lepA PE=3 SV=1 124 269 4.0E-18
sp|B0BWV5|LEPA_RICRO Elongation factor 4 OS=Rickettsia rickettsii (strain Iowa) GN=lepA PE=3 SV=1 124 269 4.0E-18
sp|B0KA85|LEPA_THEP3 Elongation factor 4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lepA PE=3 SV=1 128 297 4.0E-18
sp|Q5SKA7|LEPA_THET8 Elongation factor 4 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=lepA PE=1 SV=1 121 316 4.0E-18
sp|A3DF29|LEPA_CLOTH Elongation factor 4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=lepA PE=3 SV=1 128 269 4.0E-18
sp|C4K153|LEPA_RICPU Elongation factor 4 OS=Rickettsia peacockii (strain Rustic) GN=lepA PE=3 SV=1 124 269 4.0E-18
sp|Q8C0D5|ETUD1_MOUSE Elongation factor Tu GTP-binding domain-containing protein 1 OS=Mus musculus GN=Eftud1 PE=1 SV=1 791 955 5.0E-18
sp|A4FPM8|EFG_SACEN Elongation factor G OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=fusA PE=3 SV=1 595 922 5.0E-18
sp|Q92IQ1|LEPA_RICCN Elongation factor 4 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lepA PE=3 SV=1 124 269 5.0E-18
sp|B8I3E6|LEPA_CLOCE Elongation factor 4 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=lepA PE=3 SV=1 131 346 5.0E-18
sp|Q38BU9|GUF1_TRYB2 Translation factor GUF1 homolog, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.4600 PE=3 SV=1 127 269 5.0E-18
sp|A4QBG9|EFG_CORGB Elongation factor G OS=Corynebacterium glutamicum (strain R) GN=fusA PE=3 SV=1 583 922 7.0E-18
sp|B5ZXQ5|LEPA_RHILW Elongation factor 4 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lepA PE=3 SV=1 131 269 8.0E-18
sp|C1N1Y2|GUFP_MICPC Translation factor GUF1 homolog, chloroplastic OS=Micromonas pusilla (strain CCMP1545) GN=MICPUCDRAFT_51778 PE=3 SV=1 127 269 8.0E-18
sp|Q2KDL5|LEPA_RHIEC Elongation factor 4 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lepA PE=3 SV=1 131 269 8.0E-18
sp|Q1GIV5|LEPA_RUEST Elongation factor 4 OS=Ruegeria sp. (strain TM1040) GN=lepA PE=3 SV=1 129 335 8.0E-18
sp|C3PMX3|LEPA_RICAE Elongation factor 4 OS=Rickettsia africae (strain ESF-5) GN=lepA PE=3 SV=1 124 269 8.0E-18
sp|B3PYC6|LEPA_RHIE6 Elongation factor 4 OS=Rhizobium etli (strain CIAT 652) GN=lepA PE=3 SV=1 131 269 8.0E-18
sp|A9III9|LEPA_BORPD Elongation factor 4 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lepA PE=3 SV=1 128 307 8.0E-18
sp|Q72KV2|LEPA_THET2 Elongation factor 4 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lepA PE=3 SV=1 121 316 9.0E-18
sp|D2VRR7|GUF1_NAEGR Translation factor GUF1 homolog, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_71680 PE=3 SV=1 99 281 9.0E-18
sp|B0S1G2|LEPA_FINM2 Elongation factor 4 OS=Finegoldia magna (strain ATCC 29328) GN=lepA PE=3 SV=1 128 311 1.0E-17
sp|A2CBG9|LEPA_PROM3 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9303) GN=lepA PE=3 SV=1 131 306 1.0E-17
sp|A0Q1R8|LEPA_CLONN Elongation factor 4 OS=Clostridium novyi (strain NT) GN=lepA PE=3 SV=1 128 269 1.0E-17
sp|Q7V8S4|LEPA_PROMM Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9313) GN=lepA PE=3 SV=1 131 306 1.0E-17
sp|C4Z541|LEPA_EUBE2 Elongation factor 4 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=lepA PE=3 SV=1 128 269 1.0E-17
sp|A8LR11|LEPA_DINSH Elongation factor 4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=lepA PE=3 SV=1 129 316 1.0E-17
sp|Q5LUS0|LEPA_RUEPO Elongation factor 4 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lepA PE=3 SV=1 129 335 1.0E-17
sp|Q6MTR6|LEPA_MYCMS Elongation factor 4 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=lepA PE=3 SV=1 129 313 1.0E-17
sp|A8MFA6|LEPA_ALKOO Elongation factor 4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=lepA PE=3 SV=1 128 269 2.0E-17
sp|Q1MMQ8|LEPA_RHIL3 Elongation factor 4 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lepA PE=3 SV=1 131 269 2.0E-17
sp|Q0ICF2|LEPA_SYNS3 Elongation factor 4 OS=Synechococcus sp. (strain CC9311) GN=lepA PE=3 SV=1 128 313 2.0E-17
sp|Q0AF67|LEPA_NITEC Elongation factor 4 OS=Nitrosomonas eutropha (strain C91) GN=lepA PE=3 SV=1 128 269 2.0E-17
sp|Q92SU3|LEPA_RHIME Elongation factor 4 OS=Rhizobium meliloti (strain 1021) GN=lepA PE=3 SV=1 124 293 2.0E-17
sp|Q8F500|LEPA_LEPIN Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lepA PE=3 SV=1 128 361 2.0E-17
sp|Q72QU8|LEPA_LEPIC Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lepA PE=3 SV=1 128 361 2.0E-17
sp|Q8DI43|EFG_THEEB Elongation factor G OS=Thermosynechococcus elongatus (strain BP-1) GN=fusA PE=3 SV=1 422 920 2.0E-17
sp|A5G4G3|LEPA_GEOUR Elongation factor 4 OS=Geobacter uraniireducens (strain Rf4) GN=lepA PE=3 SV=1 128 269 2.0E-17
sp|Q0IFX5|GUF1_AEDAE Translation factor GUF1 homolog, mitochondrial OS=Aedes aegypti GN=AAEL003926 PE=3 SV=1 128 269 2.0E-17
sp|Q8N442|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1 121 269 2.0E-17
sp|A8LC59|EFG_FRASN Elongation factor G OS=Frankia sp. (strain EAN1pec) GN=fusA PE=3 SV=1 422 920 2.0E-17
sp|Q2SSF7|LEPA_MYCCT Elongation factor 4 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=lepA PE=3 SV=1 129 323 2.0E-17
sp|B6JJT7|LEPA_OLICO Elongation factor 4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=lepA PE=3 SV=1 129 269 3.0E-17
sp|Q8UIQ2|LEPA_AGRFC Elongation factor 4 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lepA PE=3 SV=1 131 293 3.0E-17
sp|Q9FLE4|GUF1_ARATH Translation factor GUF1 homolog, mitochondrial OS=Arabidopsis thaliana GN=At5g39900 PE=2 SV=1 121 270 3.0E-17
sp|Q182F4|LEPA_PEPD6 Elongation factor 4 OS=Peptoclostridium difficile (strain 630) GN=lepA PE=3 SV=1 125 269 3.0E-17
sp|Q8RB72|LEPA_CALS4 Elongation factor 4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lepA PE=3 SV=1 131 314 3.0E-17
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 128 311 3.0E-17
sp|Q0RRS4|EFG_FRAAA Elongation factor G OS=Frankia alni (strain ACN14a) GN=fusA PE=3 SV=1 537 922 3.0E-17
sp|Q9ZDQ1|LEPA_RICPR Elongation factor 4 OS=Rickettsia prowazekii (strain Madrid E) GN=lepA PE=3 SV=1 124 269 3.0E-17
sp|Q5P089|LEPA_AROAE Elongation factor 4 OS=Aromatoleum aromaticum (strain EbN1) GN=lepA PE=3 SV=1 128 316 3.0E-17
sp|Q8DTF3|LEPA_STRMU Elongation factor 4 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lepA PE=3 SV=1 123 269 4.0E-17
sp|A4SVW0|LEPA_POLSQ Elongation factor 4 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=lepA PE=3 SV=1 121 269 4.0E-17
sp|B8DIZ5|LEPA_DESVM Elongation factor 4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=lepA PE=3 SV=1 128 314 4.0E-17
sp|Q1MQF3|LEPA_LAWIP Elongation factor 4 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=lepA PE=3 SV=1 123 306 4.0E-17
sp|Q057R2|LEPA_BUCCC Elongation factor 4 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=lepA PE=3 SV=1 128 269 4.0E-17
sp|P60791|LEPA_MYCPA Elongation factor 4 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lepA PE=3 SV=1 114 269 5.0E-17
sp|Q2LTN3|LEPA_SYNAS Elongation factor 4 OS=Syntrophus aciditrophicus (strain SB) GN=lepA PE=3 SV=1 129 316 5.0E-17
sp|A5DTX8|RRF2M_LODEL Ribosome-releasing factor 2, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MEF2 PE=3 SV=1 129 668 5.0E-17
sp|P53530|LEPA_MYCLE Elongation factor 4 OS=Mycobacterium leprae (strain TN) GN=lepA PE=3 SV=1 114 269 5.0E-17
sp|B8ZUS2|LEPA_MYCLB Elongation factor 4 OS=Mycobacterium leprae (strain Br4923) GN=lepA PE=3 SV=1 114 269 5.0E-17
sp|B7G816|GUF1_PHATC Translation factor GUF1 homolog, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_22622 PE=3 SV=1 128 297 5.0E-17
sp|A0L631|LEPA_MAGMM Elongation factor 4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lepA PE=3 SV=1 131 269 5.0E-17
sp|D0NKK0|GUF1_PHYIT Translation factor GUF1 homolog, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_12454 PE=3 SV=1 127 269 5.0E-17
sp|Q8FS85|EFG_COREF Elongation factor G OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=fusA PE=3 SV=2 440 920 5.0E-17
sp|Q39US7|LEPA_GEOMG Elongation factor 4 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lepA PE=3 SV=2 128 311 5.0E-17
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 115 269 5.0E-17
sp|Q1J6V6|LEPA_STRPF Elongation factor 4 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=lepA PE=3 SV=1 122 314 5.0E-17
sp|B0C9R9|LEPA_ACAM1 Elongation factor 4 OS=Acaryochloris marina (strain MBIC 11017) GN=lepA PE=3 SV=1 129 269 5.0E-17
sp|A5GRE6|LEPA_SYNR3 Elongation factor 4 OS=Synechococcus sp. (strain RCC307) GN=lepA PE=3 SV=1 131 306 5.0E-17
sp|Q9CGI8|LEPA_LACLA Elongation factor 4 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lepA PE=3 SV=1 128 269 5.0E-17
sp|B5XLC6|LEPA_STRPZ Elongation factor 4 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lepA PE=3 SV=1 122 314 6.0E-17
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 131 316 6.0E-17
sp|A9BNJ8|LEPA_DELAS Elongation factor 4 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=lepA PE=3 SV=1 131 269 6.0E-17
sp|A2RL76|LEPA_LACLM Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lepA PE=3 SV=1 128 269 6.0E-17
sp|Q02Z80|LEPA_LACLS Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=lepA PE=3 SV=1 128 269 6.0E-17
sp|P60794|LEPA_TREDE Elongation factor 4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lepA PE=3 SV=1 127 269 6.0E-17
sp|Q48TU0|LEPA_STRPM Elongation factor 4 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lepA PE=3 SV=1 122 314 6.0E-17
sp|Q1JLY8|LEPA_STRPC Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lepA PE=3 SV=1 122 314 6.0E-17
sp|Q99ZV8|LEPA_STRP1 Elongation factor 4 OS=Streptococcus pyogenes serotype M1 GN=lepA PE=3 SV=1 122 314 6.0E-17
sp|A5VB59|LEPA_SPHWW Elongation factor 4 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lepA PE=3 SV=1 124 269 6.0E-17
sp|Q1JH37|LEPA_STRPD Elongation factor 4 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=lepA PE=3 SV=1 122 314 6.0E-17
sp|Q5XCD2|LEPA_STRP6 Elongation factor 4 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lepA PE=3 SV=1 122 314 6.0E-17
sp|Q2J2Y0|LEPA_RHOP2 Elongation factor 4 OS=Rhodopseudomonas palustris (strain HaA2) GN=lepA PE=3 SV=2 131 269 7.0E-17
sp|A2BV79|LEPA_PROM5 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9515) GN=lepA PE=3 SV=1 129 306 7.0E-17
sp|Q1JC06|LEPA_STRPB Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lepA PE=3 SV=1 122 314 7.0E-17
sp|Q9RV84|LEPA_DEIRA Elongation factor 4 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lepA PE=3 SV=1 129 269 7.0E-17
sp|Q1BDD4|EFG_MYCSS Elongation factor G OS=Mycobacterium sp. (strain MCS) GN=fusA PE=3 SV=1 595 922 7.0E-17
sp|A1UBL0|EFG_MYCSK Elongation factor G OS=Mycobacterium sp. (strain KMS) GN=fusA PE=3 SV=1 595 922 7.0E-17
sp|A3PV95|EFG_MYCSJ Elongation factor G OS=Mycobacterium sp. (strain JLS) GN=fusA PE=3 SV=1 595 922 7.0E-17
sp|Q13E78|LEPA_RHOPS Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB5) GN=lepA PE=3 SV=2 131 269 8.0E-17
sp|Q68X95|LEPA_RICTY Elongation factor 4 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lepA PE=3 SV=1 124 269 8.0E-17
sp|B3Q991|LEPA_RHOPT Elongation factor 4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=lepA PE=3 SV=1 131 269 8.0E-17
sp|P60793|LEPA_RHOPA Elongation factor 4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lepA PE=3 SV=1 131 269 8.0E-17
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 462 920 8.0E-17
sp|Q4UKS2|LEPA_RICFE Elongation factor 4 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lepA PE=3 SV=1 124 269 8.0E-17
sp|C1AYS4|EFG_RHOOB Elongation factor G OS=Rhodococcus opacus (strain B4) GN=fusA PE=3 SV=1 502 922 8.0E-17
sp|Q7U5L9|LEPA_SYNPX Elongation factor 4 OS=Synechococcus sp. (strain WH8102) GN=lepA PE=3 SV=1 129 313 9.0E-17
sp|Q8RFD1|LEPA_FUSNN Elongation factor 4 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lepA PE=3 SV=1 121 269 9.0E-17
sp|Q6MEF3|LEPA_PARUW Elongation factor 4 OS=Protochlamydia amoebophila (strain UWE25) GN=lepA PE=3 SV=1 128 269 9.0E-17
sp|Q0SFF3|EFG_RHOJR Elongation factor G OS=Rhodococcus jostii (strain RHA1) GN=fusA PE=3 SV=1 502 922 9.0E-17
sp|A0LI00|LEPA_SYNFM Elongation factor 4 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=lepA PE=3 SV=1 129 271 9.0E-17
sp|Q72E76|LEPA_DESVH Elongation factor 4 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lepA PE=3 SV=1 128 269 9.0E-17
sp|C4Z9E3|LEPA_EUBR3 Elongation factor 4 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=lepA PE=3 SV=1 129 269 9.0E-17
sp|Q8C3X4|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=1 SV=1 122 269 9.0E-17
sp|Q3AF13|LEPA_CARHZ Elongation factor 4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lepA PE=3 SV=1 131 316 1.0E-16
sp|Q7VDF7|LEPA_PROMA Elongation factor 4 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=lepA PE=3 SV=1 131 313 1.0E-16
sp|Q0AWL9|LEPA_SYNWW Elongation factor 4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lepA PE=3 SV=1 128 269 1.0E-16
sp|B9M4U5|LEPA_GEODF Elongation factor 4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=lepA PE=3 SV=1 131 269 1.0E-16
sp|A4HAG7|GUF1_LEIBR Translation factor GUF1 homolog, mitochondrial OS=Leishmania braziliensis GN=LbrM20_V2.0500 PE=3 SV=1 123 272 1.0E-16
sp|P60789|LEPA_GEOSL Elongation factor 4 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lepA PE=3 SV=1 131 311 1.0E-16
sp|Q7V2Q1|LEPA_PROMP Elongation factor 4 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=lepA PE=3 SV=1 129 306 1.0E-16
sp|B3QPU3|LEPA_CHLP8 Elongation factor 4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=lepA PE=3 SV=1 131 269 1.0E-16
sp|Q6G550|LEPA_BARHE Elongation factor 4 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lepA PE=3 SV=1 131 269 1.0E-16
sp|Q21XN4|LEPA_RHOFT Elongation factor 4 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=lepA PE=3 SV=1 131 269 1.0E-16
sp|Q8CXD0|LEPA_OCEIH Elongation factor 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lepA PE=3 SV=1 123 310 1.0E-16
sp|A8GW16|LEPA_RICB8 Elongation factor 4 OS=Rickettsia bellii (strain OSU 85-389) GN=lepA PE=3 SV=1 124 269 1.0E-16
sp|Q7VL73|LEPA_HAEDU Elongation factor 4 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lepA PE=3 SV=2 128 269 1.0E-16
sp|Q07TF1|LEPA_RHOP5 Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisA53) GN=lepA PE=3 SV=1 131 269 1.0E-16
sp|Q6G1F5|LEPA_BARQU Elongation factor 4 OS=Bartonella quintana (strain Toulouse) GN=lepA PE=3 SV=1 131 269 1.0E-16
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 462 920 1.0E-16
sp|B5EB36|LEPA_GEOBB Elongation factor 4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lepA PE=3 SV=1 128 311 1.0E-16
sp|Q2KWY3|LEPA_BORA1 Elongation factor 4 OS=Bordetella avium (strain 197N) GN=lepA PE=3 SV=1 128 269 1.0E-16
sp|B3E9R0|LEPA_GEOLS Elongation factor 4 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=lepA PE=3 SV=1 129 311 1.0E-16
sp|A4WX88|LEPA_RHOS5 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=lepA PE=3 SV=1 131 269 1.0E-16
sp|Q47EG0|LEPA_DECAR Elongation factor 4 OS=Dechloromonas aromatica (strain RCB) GN=lepA PE=3 SV=1 131 316 1.0E-16
sp|Q3YSC2|LEPA_EHRCJ Elongation factor 4 OS=Ehrlichia canis (strain Jake) GN=lepA PE=3 SV=1 131 269 1.0E-16
sp|B9DSE0|LEPA_STRU0 Elongation factor 4 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=lepA PE=3 SV=1 122 269 1.0E-16
sp|Q1B684|LEPA_MYCSS Elongation factor 4 OS=Mycobacterium sp. (strain MCS) GN=lepA PE=3 SV=1 114 269 1.0E-16
sp|A1UIU2|LEPA_MYCSK Elongation factor 4 OS=Mycobacterium sp. (strain KMS) GN=lepA PE=3 SV=1 114 269 1.0E-16
sp|A3Q2A6|LEPA_MYCSJ Elongation factor 4 OS=Mycobacterium sp. (strain JLS) GN=lepA PE=3 SV=1 114 269 1.0E-16
sp|B0BB51|LEPA_CHLTB Elongation factor 4 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=lepA PE=3 SV=1 128 313 1.0E-16
sp|B0B9H2|LEPA_CHLT2 Elongation factor 4 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=lepA PE=3 SV=1 128 313 1.0E-16
sp|B8ENL1|LEPA_METSB Elongation factor 4 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lepA PE=3 SV=1 128 269 1.0E-16
sp|A4IR35|LEPA_GEOTN Elongation factor 4 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lepA PE=3 SV=1 128 269 1.0E-16
sp|O84067|LEPA_CHLTR Elongation factor 4 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lepA PE=3 SV=1 128 313 1.0E-16
sp|Q3KMV7|LEPA_CHLTA Elongation factor 4 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=lepA PE=3 SV=1 128 313 2.0E-16
sp|Q7W5J4|LEPA_BORPA Elongation factor 4 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lepA PE=3 SV=1 128 269 2.0E-16
sp|Q7WD30|LEPA_BORBR Elongation factor 4 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lepA PE=3 SV=1 128 269 2.0E-16
sp|C4L433|LEPA_EXISA Elongation factor 4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=lepA PE=3 SV=1 122 307 2.0E-16
sp|A8G3D2|LEPA_PROM2 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9215) GN=lepA PE=3 SV=1 129 306 2.0E-16
sp|Q31CB8|LEPA_PROM9 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9312) GN=lepA PE=3 SV=1 129 306 2.0E-16
sp|Q31R08|LEPA_SYNE7 Elongation factor 4 OS=Synechococcus elongatus (strain PCC 7942) GN=lepA PE=3 SV=1 129 293 2.0E-16
sp|C6BST2|LEPA_DESAD Elongation factor 4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=lepA PE=3 SV=1 129 297 2.0E-16
sp|A7GHI0|LEPA_CLOBL Elongation factor 4 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lepA PE=3 SV=1 131 269 2.0E-16
sp|B1ILM7|LEPA_CLOBK Elongation factor 4 OS=Clostridium botulinum (strain Okra / Type B1) GN=lepA PE=3 SV=1 131 269 2.0E-16
sp|A2BPP8|LEPA_PROMS Elongation factor 4 OS=Prochlorococcus marinus (strain AS9601) GN=lepA PE=3 SV=1 129 306 2.0E-16
sp|C1FVU4|LEPA_CLOBJ Elongation factor 4 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=lepA PE=3 SV=1 131 269 2.0E-16
sp|B3WEQ5|LEPA_LACCB Elongation factor 4 OS=Lactobacillus casei (strain BL23) GN=lepA PE=3 SV=1 122 269 2.0E-16
sp|Q038N6|LEPA_LACC3 Elongation factor 4 OS=Lactobacillus casei (strain ATCC 334) GN=lepA PE=3 SV=1 122 269 2.0E-16
sp|Q3ALG5|LEPA_SYNSC Elongation factor 4 OS=Synechococcus sp. (strain CC9605) GN=lepA PE=3 SV=1 129 313 2.0E-16
sp|A5N6L8|LEPA_CLOK5 Elongation factor 4 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lepA PE=3 SV=1 128 269 2.0E-16
sp|A3PBD8|LEPA_PROM0 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9301) GN=lepA PE=3 SV=1 129 306 2.0E-16
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 122 269 2.0E-16
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 128 311 2.0E-16
sp|Q24SR6|LEPA_DESHY Elongation factor 4 OS=Desulfitobacterium hafniense (strain Y51) GN=lepA PE=3 SV=1 128 269 2.0E-16
sp|B8FUP2|LEPA_DESHD Elongation factor 4 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=lepA PE=3 SV=1 128 269 2.0E-16
sp|A7MH13|LEPA_CROS8 Elongation factor 4 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|P0A1W4|LEPA_SALTY Elongation factor 4 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|P0A1W5|LEPA_SALTI Elongation factor 4 OS=Salmonella typhi GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|B4TS16|LEPA_SALSV Elongation factor 4 OS=Salmonella schwarzengrund (strain CVM19633) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|B4T1G0|LEPA_SALNS Elongation factor 4 OS=Salmonella newport (strain SL254) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|B4TE17|LEPA_SALHS Elongation factor 4 OS=Salmonella heidelberg (strain SL476) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|B5QTV0|LEPA_SALEP Elongation factor 4 OS=Salmonella enteritidis PT4 (strain P125109) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|B5FRC7|LEPA_SALDC Elongation factor 4 OS=Salmonella dublin (strain CT_02021853) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|Q57LC8|LEPA_SALCH Elongation factor 4 OS=Salmonella choleraesuis (strain SC-B67) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|B5F1G3|LEPA_SALA4 Elongation factor 4 OS=Salmonella agona (strain SL483) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|B5BAS8|LEPA_SALPK Elongation factor 4 OS=Salmonella paratyphi A (strain AKU_12601) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|Q5PNC0|LEPA_SALPA Elongation factor 4 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|B5RD51|LEPA_SALG2 Elongation factor 4 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|C0PYG5|LEPA_SALPC Elongation factor 4 OS=Salmonella paratyphi C (strain RKS4594) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|Q89BJ8|LEPA_BRADU Elongation factor 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lepA PE=3 SV=2 131 269 2.0E-16
sp|C1F2I3|LEPA_ACIC5 Elongation factor 4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=lepA PE=3 SV=1 131 307 2.0E-16
sp|Q4DZ91|GUF12_TRYCC Translation factor GUF1 homolog 2, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053504105.210 PE=3 SV=1 116 272 2.0E-16
sp|A9MGX5|LEPA_SALAR Elongation factor 4 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lepA PE=3 SV=1 128 297 2.0E-16
sp|Q28LR4|LEPA_JANSC Elongation factor 4 OS=Jannaschia sp. (strain CCS1) GN=lepA PE=3 SV=1 128 269 2.0E-16
sp|Q2G550|LEPA_NOVAD Elongation factor 4 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=lepA PE=3 SV=1 131 316 2.0E-16
sp|Q6FUQ6|EFGM_CANGA Elongation factor G, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEF1 PE=3 SV=1 121 319 2.0E-16
sp|Q6NJD6|EFG_CORDI Elongation factor G OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=fusA PE=3 SV=2 440 920 2.0E-16
sp|C5D3R4|EFG_GEOSW Elongation factor G OS=Geobacillus sp. (strain WCH70) GN=fusA PE=3 SV=1 440 926 3.0E-16
sp|B1KZP1|LEPA_CLOBM Elongation factor 4 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lepA PE=3 SV=1 131 269 3.0E-16
sp|Q112D2|LEPA_TRIEI Elongation factor 4 OS=Trichodesmium erythraeum (strain IMS101) GN=lepA PE=3 SV=1 129 269 3.0E-16
sp|A4XKA0|LEPA_CALS8 Elongation factor 4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lepA PE=3 SV=1 129 314 3.0E-16
sp|B3QZT9|LEPA_PHYMT Elongation factor 4 OS=Phytoplasma mali (strain AT) GN=lepA PE=3 SV=1 125 269 3.0E-16
sp|A5I644|LEPA_CLOBH Elongation factor 4 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lepA PE=3 SV=1 131 269 3.0E-16
sp|A7FXL9|LEPA_CLOB1 Elongation factor 4 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lepA PE=3 SV=1 131 269 3.0E-16
sp|A1WAW8|LEPA_ACISJ Elongation factor 4 OS=Acidovorax sp. (strain JS42) GN=lepA PE=3 SV=1 131 269 3.0E-16
sp|B9MDP9|LEPA_ACIET Elongation factor 4 OS=Acidovorax ebreus (strain TPSY) GN=lepA PE=3 SV=1 131 269 3.0E-16
sp|Q9RDC9|LEPA_STRCO Elongation factor 4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lepA PE=3 SV=1 127 269 3.0E-16
sp|C3L3H1|LEPA_CLOB6 Elongation factor 4 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=lepA PE=3 SV=1 131 269 3.0E-16
sp|P0DC23|LEPA_STRPQ Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lepA PE=3 SV=1 122 314 3.0E-16
sp|P0DC22|LEPA_STRP3 Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lepA PE=3 SV=1 122 314 3.0E-16
sp|Q5KWZ3|LEPA_GEOKA Elongation factor 4 OS=Geobacillus kaustophilus (strain HTA426) GN=lepA PE=3 SV=1 128 269 3.0E-16
sp|B2GBR9|LEPA_LACF3 Elongation factor 4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lepA PE=3 SV=1 128 293 3.0E-16
sp|Q46GZ6|LEPA_PROMT Elongation factor 4 OS=Prochlorococcus marinus (strain NATL2A) GN=lepA PE=3 SV=1 123 306 3.0E-16
sp|A2C0M8|LEPA_PROM1 Elongation factor 4 OS=Prochlorococcus marinus (strain NATL1A) GN=lepA PE=3 SV=1 123 306 3.0E-16
sp|A8GMT1|LEPA_RICAH Elongation factor 4 OS=Rickettsia akari (strain Hartford) GN=lepA PE=3 SV=1 124 269 3.0E-16
sp|Q576S5|LEPA_BRUAB Elongation factor 4 OS=Brucella abortus biovar 1 (strain 9-941) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|Q2YJP8|LEPA_BRUA2 Elongation factor 4 OS=Brucella abortus (strain 2308) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|B2SC25|LEPA_BRUA1 Elongation factor 4 OS=Brucella abortus (strain S19) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|O25225|TYPA_HELPY GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=typA PE=3 SV=1 128 270 3.0E-16
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 129 269 3.0E-16
sp|Q8YDB8|LEPA_BRUME Elongation factor 4 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|C0RMH8|LEPA_BRUMB Elongation factor 4 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|A6WYK4|LEPA_OCHA4 Elongation factor 4 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|A9ADE0|LEPA_BURM1 Elongation factor 4 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=lepA PE=3 SV=1 131 269 3.0E-16
sp|A5UFI9|LEPA_HAEIG Elongation factor 4 OS=Haemophilus influenzae (strain PittGG) GN=lepA PE=3 SV=1 128 297 3.0E-16
sp|A5UBC2|LEPA_HAEIE Elongation factor 4 OS=Haemophilus influenzae (strain PittEE) GN=lepA PE=3 SV=1 128 297 3.0E-16
sp|Q4QPM8|LEPA_HAEI8 Elongation factor 4 OS=Haemophilus influenzae (strain 86-028NP) GN=lepA PE=3 SV=1 128 297 3.0E-16
sp|Q8FV17|LEPA_BRUSU Elongation factor 4 OS=Brucella suis biovar 1 (strain 1330) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|A9WW49|LEPA_BRUSI Elongation factor 4 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|A5VVU4|LEPA_BRUO2 Elongation factor 4 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|A9MCW5|LEPA_BRUC2 Elongation factor 4 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lepA PE=3 SV=1 131 293 3.0E-16
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 129 269 3.0E-16
sp|A3PHQ9|LEPA_RHOS1 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=lepA PE=3 SV=1 131 269 3.0E-16
sp|P43729|LEPA_HAEIN Elongation factor 4 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lepA PE=3 SV=1 128 297 3.0E-16
sp|A1VRT5|LEPA_POLNA Elongation factor 4 OS=Polaromonas naphthalenivorans (strain CJ2) GN=lepA PE=3 SV=1 131 307 3.0E-16
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 128 347 3.0E-16
sp|A5GMR2|LEPA_SYNPW Elongation factor 4 OS=Synechococcus sp. (strain WH7803) GN=lepA PE=3 SV=1 129 313 3.0E-16
sp|B9KNH9|LEPA_RHOSK Elongation factor 4 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=lepA PE=3 SV=1 131 269 3.0E-16
sp|B0U3D5|LEPA_XYLFM Elongation factor 4 OS=Xylella fastidiosa (strain M12) GN=lepA PE=3 SV=1 128 269 3.0E-16
sp|Q0ATE3|LEPA_MARMM Elongation factor 4 OS=Maricaulis maris (strain MCS10) GN=lepA PE=3 SV=2 127 269 3.0E-16
sp|Q1LKM8|LEPA_CUPMC Elongation factor 4 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lepA PE=3 SV=1 131 307 3.0E-16
sp|B9W892|RRF2M_CANDC Ribosome-releasing factor 2, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MEF2 PE=3 SV=1 129 270 3.0E-16
sp|A9BE39|LEPA_PROM4 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9211) GN=lepA PE=3 SV=1 123 306 3.0E-16
sp|Q3A445|LEPA_PELCD Elongation factor 4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lepA PE=3 SV=1 129 269 3.0E-16
sp|O67618|LEPA_AQUAE Elongation factor 4 OS=Aquifex aeolicus (strain VF5) GN=lepA PE=1 SV=1 128 293 4.0E-16
sp|A0K5V7|LEPA_BURCH Elongation factor 4 OS=Burkholderia cenocepacia (strain HI2424) GN=lepA PE=3 SV=1 131 269 4.0E-16
sp|B1JYB1|LEPA_BURCC Elongation factor 4 OS=Burkholderia cenocepacia (strain MC0-3) GN=lepA PE=3 SV=1 131 269 4.0E-16
sp|Q1BXU3|LEPA_BURCA Elongation factor 4 OS=Burkholderia cenocepacia (strain AU 1054) GN=lepA PE=3 SV=1 131 269 4.0E-16
sp|C0ZVT6|EFG_RHOE4 Elongation factor G OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=fusA PE=3 SV=1 502 922 4.0E-16
sp|Q9PBA1|LEPA_XYLFA Elongation factor 4 OS=Xylella fastidiosa (strain 9a5c) GN=lepA PE=3 SV=1 128 269 4.0E-16
sp|A2SDH0|LEPA_METPP Elongation factor 4 OS=Methylibium petroleiphilum (strain PM1) GN=lepA PE=3 SV=1 131 269 4.0E-16
sp|Q0BH06|LEPA_BURCM Elongation factor 4 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=lepA PE=3 SV=1 131 269 4.0E-16
sp|B1YVM2|LEPA_BURA4 Elongation factor 4 OS=Burkholderia ambifaria (strain MC40-6) GN=lepA PE=3 SV=1 131 269 4.0E-16
sp|A7IEG8|LEPA_XANP2 Elongation factor 4 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lepA PE=3 SV=1 128 269 4.0E-16
sp|Q87C09|LEPA_XYLFT Elongation factor 4 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=lepA PE=3 SV=1 128 269 4.0E-16
sp|B2I601|LEPA_XYLF2 Elongation factor 4 OS=Xylella fastidiosa (strain M23) GN=lepA PE=3 SV=1 128 269 4.0E-16
sp|Q3YYU7|LEPA_SHISS Elongation factor 4 OS=Shigella sonnei (strain Ss046) GN=lepA PE=3 SV=1 128 297 4.0E-16
sp|Q46Z15|LEPA_CUPPJ Elongation factor 4 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lepA PE=3 SV=1 131 307 4.0E-16
sp|Q39I75|LEPA_BURL3 Elongation factor 4 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lepA PE=3 SV=1 131 269 4.0E-16
sp|Q4FNH3|LEPA_PELUB Elongation factor 4 OS=Pelagibacter ubique (strain HTCC1062) GN=lepA PE=3 SV=1 131 307 4.0E-16
sp|P56865|LEPA_BORPE Elongation factor 4 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lepA PE=3 SV=2 128 269 4.0E-16
sp|B0USR9|LEPA_HISS2 Elongation factor 4 OS=Histophilus somni (strain 2336) GN=lepA PE=3 SV=1 128 269 4.0E-16
sp|Q0I4Z1|LEPA_HAES1 Elongation factor 4 OS=Haemophilus somnus (strain 129Pt) GN=lepA PE=3 SV=1 128 269 4.0E-16
sp|Q3SVT1|LEPA_NITWN Elongation factor 4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lepA PE=3 SV=1 131 269 4.0E-16
sp|A4VUL8|LEPA_STRSY Elongation factor 4 OS=Streptococcus suis (strain 05ZYH33) GN=lepA PE=3 SV=1 122 307 4.0E-16
sp|A4W0W0|LEPA_STRS2 Elongation factor 4 OS=Streptococcus suis (strain 98HAH33) GN=lepA PE=3 SV=1 122 307 4.0E-16
sp|A9KKU4|LEPA_CLOPH Elongation factor 4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lepA PE=3 SV=1 128 314 4.0E-16
sp|B1XZN0|LEPA_LEPCP Elongation factor 4 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=lepA PE=3 SV=1 131 269 4.0E-16
sp|Q3J4P0|LEPA_RHOS4 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=lepA PE=3 SV=2 131 269 4.0E-16
sp|Q6F0Z2|LEPA_MESFL Elongation factor 4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=lepA PE=3 SV=1 129 313 4.0E-16
sp|A6VAK9|LEPA_PSEA7 Elongation factor 4 OS=Pseudomonas aeruginosa (strain PA7) GN=lepA PE=3 SV=1 131 307 4.0E-16
sp|Q1QR19|LEPA_NITHX Elongation factor 4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lepA PE=3 SV=1 131 269 5.0E-16
sp|P60788|LEPA_SHIFL Elongation factor 4 OS=Shigella flexneri GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|Q0T1T6|LEPA_SHIF8 Elongation factor 4 OS=Shigella flexneri serotype 5b (strain 8401) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|Q31XR8|LEPA_SHIBS Elongation factor 4 OS=Shigella boydii serotype 4 (strain Sb227) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B2TYI0|LEPA_SHIB3 Elongation factor 4 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B7LUZ5|LEPA_ESCF3 Elongation factor 4 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B1LP82|LEPA_ECOSM Elongation factor 4 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B7N6F7|LEPA_ECOLU Elongation factor 4 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|P60785|LEPA_ECOLI Elongation factor 4 OS=Escherichia coli (strain K12) GN=lepA PE=1 SV=1 128 297 5.0E-16
sp|B1IVQ8|LEPA_ECOLC Elongation factor 4 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|P60786|LEPA_ECOL6 Elongation factor 4 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|Q0TER9|LEPA_ECOL5 Elongation factor 4 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|A8A379|LEPA_ECOHS Elongation factor 4 OS=Escherichia coli O9:H4 (strain HS) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B1XB43|LEPA_ECODH Elongation factor 4 OS=Escherichia coli (strain K12 / DH10B) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|C4ZYJ2|LEPA_ECOBW Elongation factor 4 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B7NRM2|LEPA_ECO7I Elongation factor 4 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B5Z143|LEPA_ECO5E Elongation factor 4 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|P60787|LEPA_ECO57 Elongation factor 4 OS=Escherichia coli O157:H7 GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B7LDG2|LEPA_ECO55 Elongation factor 4 OS=Escherichia coli (strain 55989 / EAEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|A7ZQ13|LEPA_ECO24 Elongation factor 4 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|A6Q241|LEPA_NITSB Elongation factor 4 OS=Nitratiruptor sp. (strain SB155-2) GN=lepA PE=3 SV=1 128 269 5.0E-16
sp|A0KGF0|LEPA_AERHH Elongation factor 4 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lepA PE=3 SV=1 128 269 5.0E-16
sp|B6I5E3|LEPA_ECOSE Elongation factor 4 OS=Escherichia coli (strain SE11) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|Q9PKX6|LEPA_CHLMU Elongation factor 4 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lepA PE=3 SV=1 128 313 5.0E-16
sp|Q5ZUD2|LEPA_LEGPH Elongation factor 4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lepA PE=3 SV=1 129 269 5.0E-16
sp|A5ID24|LEPA_LEGPC Elongation factor 4 OS=Legionella pneumophila (strain Corby) GN=lepA PE=3 SV=1 129 269 5.0E-16
sp|Q5X443|LEPA_LEGPA Elongation factor 4 OS=Legionella pneumophila (strain Paris) GN=lepA PE=3 SV=1 129 269 5.0E-16
sp|Q1R8G3|LEPA_ECOUT Elongation factor 4 OS=Escherichia coli (strain UTI89 / UPEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|A1AE99|LEPA_ECOK1 Elongation factor 4 OS=Escherichia coli O1:K1 / APEC GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B7MYK1|LEPA_ECO81 Elongation factor 4 OS=Escherichia coli O81 (strain ED1a) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B7MIQ4|LEPA_ECO45 Elongation factor 4 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|B7UH09|LEPA_ECO27 Elongation factor 4 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|P65274|LEPA_STRA5 Elongation factor 4 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lepA PE=3 SV=1 122 269 5.0E-16
sp|P65273|LEPA_STRA3 Elongation factor 4 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lepA PE=3 SV=1 122 269 5.0E-16
sp|Q3K1F9|LEPA_STRA1 Elongation factor 4 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lepA PE=3 SV=1 122 269 5.0E-16
sp|B7M8I2|LEPA_ECO8A Elongation factor 4 OS=Escherichia coli O8 (strain IAI1) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|Q32CV2|LEPA_SHIDS Elongation factor 4 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lepA PE=3 SV=1 128 297 5.0E-16
sp|A7GT14|LEPA_BACCN Elongation factor 4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lepA PE=3 SV=1 129 314 5.0E-16
sp|A1WMW4|LEPA_VEREI Elongation factor 4 OS=Verminephrobacter eiseniae (strain EF01-2) GN=lepA PE=3 SV=1 128 307 5.0E-16
sp|Q9I5G8|LEPA_PSEAE Elongation factor 4 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lepA PE=3 SV=1 131 307 5.0E-16
sp|Q02HR9|LEPA_PSEAB Elongation factor 4 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lepA PE=3 SV=1 131 307 5.0E-16
sp|B7UYX5|LEPA_PSEA8 Elongation factor 4 OS=Pseudomonas aeruginosa (strain LESB58) GN=lepA PE=3 SV=1 131 307 5.0E-16
sp|C5BRN3|LEPA_TERTT Elongation factor 4 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=lepA PE=3 SV=1 131 269 5.0E-16
sp|Q4DKF7|GUF11_TRYCC Translation factor GUF1 homolog 1, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053503697.90 PE=3 SV=1 116 272 5.0E-16
sp|A8EY28|LEPA_RICCK Elongation factor 4 OS=Rickettsia canadensis (strain McKiel) GN=lepA PE=3 SV=1 124 269 6.0E-16
sp|B3PLG4|LEPA_CELJU Elongation factor 4 OS=Cellvibrio japonicus (strain Ueda107) GN=lepA PE=3 SV=1 131 269 6.0E-16
sp|Q98DV1|LEPA_RHILO Elongation factor 4 OS=Rhizobium loti (strain MAFF303099) GN=lepA PE=3 SV=1 129 269 6.0E-16
sp|Q65VN2|LEPA_MANSM Elongation factor 4 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=lepA PE=3 SV=2 128 297 6.0E-16
sp|Q5FHQ1|LEPA_EHRRG Elongation factor 4 OS=Ehrlichia ruminantium (strain Gardel) GN=lepA PE=3 SV=1 121 269 6.0E-16
sp|Q8PB55|LEPA_XANCP Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lepA PE=3 SV=1 128 269 6.0E-16
sp|B0RX30|LEPA_XANCB Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain B100) GN=lepA PE=3 SV=1 128 269 6.0E-16
sp|Q4USF4|LEPA_XANC8 Elongation factor 4 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lepA PE=3 SV=1 128 269 6.0E-16
sp|Q5AAV3|RRF2M_CANAL Ribosome-releasing factor 2, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEF2 PE=3 SV=1 129 270 6.0E-16
sp|Q9A9F4|LEPA_CAUCR Elongation factor 4 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lepA PE=3 SV=2 129 269 6.0E-16
sp|A6TCI3|LEPA_KLEP7 Elongation factor 4 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lepA PE=3 SV=1 128 269 6.0E-16
sp|Q892Q6|LEPA_CLOTE Elongation factor 4 OS=Clostridium tetani (strain Massachusetts / E88) GN=lepA PE=3 SV=2 128 269 7.0E-16
sp|Q0K8N0|LEPA_CUPNH Elongation factor 4 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=lepA PE=3 SV=1 131 307 7.0E-16
sp|Q5HBH4|LEPA_EHRRW Elongation factor 4 OS=Ehrlichia ruminantium (strain Welgevonden) GN=lepA PE=3 SV=1 121 269 7.0E-16
sp|B0G189|GUF1_DICDI Translation factor GUF1 homolog, mitochondrial OS=Dictyostelium discoideum GN=guf1 PE=3 SV=1 131 269 7.0E-16
sp|A4RZA6|GUFP_OSTLU Translation factor GUF1 homolog, chloroplastic OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_15891 PE=3 SV=1 128 269 7.0E-16
sp|B8H2Z7|LEPA_CAUCN Elongation factor 4 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lepA PE=3 SV=1 129 269 7.0E-16
sp|Q5N390|LEPA_SYNP6 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=lepA PE=3 SV=2 129 293 7.0E-16
sp|Q5WLR5|EFG_BACSK Elongation factor G OS=Bacillus clausii (strain KSM-K16) GN=fusA PE=3 SV=1 428 920 7.0E-16
sp|A8AWG3|LEPA_STRGC Elongation factor 4 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lepA PE=3 SV=1 122 269 7.0E-16
sp|Q0RP81|LEPA_FRAAA Elongation factor 4 OS=Frankia alni (strain ACN14a) GN=lepA PE=3 SV=1 127 269 8.0E-16
sp|Q0C5X0|LEPA_HYPNA Elongation factor 4 OS=Hyphomonas neptunium (strain ATCC 15444) GN=lepA PE=3 SV=1 129 293 8.0E-16
sp|P9WK97|LEPA_MYCTU Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lepA PE=1 SV=1 114 269 8.0E-16
sp|P9WK96|LEPA_MYCTO Elongation factor 4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lepA PE=3 SV=1 114 269 8.0E-16
sp|A5U598|LEPA_MYCTA Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lepA PE=3 SV=1 114 269 8.0E-16
sp|C1AQW9|LEPA_MYCBT Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lepA PE=3 SV=1 114 269 8.0E-16
sp|A1KL96|LEPA_MYCBP Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lepA PE=3 SV=1 114 269 8.0E-16
sp|P65270|LEPA_MYCBO Elongation factor 4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lepA PE=3 SV=1 114 269 8.0E-16
sp|B2G6W5|LEPA_LACRJ Elongation factor 4 OS=Lactobacillus reuteri (strain JCM 1112) GN=lepA PE=3 SV=1 128 293 8.0E-16
sp|A5VJE9|LEPA_LACRD Elongation factor 4 OS=Lactobacillus reuteri (strain DSM 20016) GN=lepA PE=3 SV=1 128 293 8.0E-16
sp|Q03QU8|LEPA_LACBA Elongation factor 4 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=lepA PE=3 SV=1 123 313 8.0E-16
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 122 269 8.0E-16
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 128 269 8.0E-16
sp|Q9ZLZ3|TYPA_HELPJ GTP-binding protein TypA/BipA homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=typA PE=3 SV=1 128 270 8.0E-16
sp|A9S3D3|GUF1_PHYPA Translation factor GUF1 homolog, mitochondrial OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_180825 PE=3 SV=1 121 271 8.0E-16
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 122 269 8.0E-16
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 122 269 8.0E-16
sp|Q8Y742|LEPA_LISMO Elongation factor 4 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lepA PE=3 SV=1 124 307 8.0E-16
sp|B8DE32|LEPA_LISMH Elongation factor 4 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=lepA PE=3 SV=1 124 307 8.0E-16
sp|Q71ZJ1|LEPA_LISMF Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lepA PE=3 SV=1 124 307 8.0E-16
sp|C1KVC6|LEPA_LISMC Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=lepA PE=3 SV=1 124 307 8.0E-16
sp|B1XTL2|LEPA_POLNS Elongation factor 4 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=lepA PE=3 SV=1 121 269 9.0E-16
sp|B1VET0|EFG_CORU7 Elongation factor G OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=fusA PE=3 SV=1 595 920 9.0E-16
sp|P57806|LEPA_PASMU Elongation factor 4 OS=Pasteurella multocida (strain Pm70) GN=lepA PE=3 SV=1 128 297 9.0E-16
sp|Q118Z3|EFG1_TRIEI Elongation factor G 1 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA1 PE=3 SV=1 424 920 9.0E-16
sp|Q2JDK2|LEPA_FRASC Elongation factor 4 OS=Frankia sp. (strain CcI3) GN=lepA PE=3 SV=2 127 269 9.0E-16
sp|A6VLV6|LEPA_ACTSZ Elongation factor 4 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lepA PE=3 SV=1 128 297 9.0E-16
sp|Q1IXW5|LEPA_DEIGD Elongation factor 4 OS=Deinococcus geothermalis (strain DSM 11300) GN=lepA PE=3 SV=1 129 269 9.0E-16
sp|Q126K0|LEPA_POLSJ Elongation factor 4 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=lepA PE=3 SV=1 131 316 9.0E-16
sp|Q4Q3F0|GUF1_LEIMA Translation factor GUF1 homolog, mitochondrial OS=Leishmania major GN=LmjF34.0570 PE=3 SV=1 123 272 9.0E-16
sp|C5Z3W1|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1 127 270 9.0E-16
sp|Q97JJ6|LEPA_CLOAB Elongation factor 4 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lepA PE=3 SV=1 128 313 1.0E-15
sp|Q1GRH5|LEPA_SPHAL Elongation factor 4 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=lepA PE=3 SV=1 129 314 1.0E-15
sp|A9GWZ4|LEPA_SORC5 Elongation factor 4 OS=Sorangium cellulosum (strain So ce56) GN=lepA PE=3 SV=1 131 307 1.0E-15
sp|B0WXB8|GUF1_CULQU Translation factor GUF1 homolog, mitochondrial OS=Culex quinquefasciatus GN=CPIJ012086 PE=3 SV=1 129 269 1.0E-15
sp|A4I9M7|GUF1_LEIIN Translation factor GUF1 homolog, mitochondrial OS=Leishmania infantum GN=LinJ34.0590 PE=3 SV=1 123 272 1.0E-15
sp|Q30XI4|LEPA_DESAG Elongation factor 4 OS=Desulfovibrio alaskensis (strain G20) GN=lepA PE=3 SV=1 131 269 1.0E-15
sp|Q5NLP5|LEPA_ZYMMO Elongation factor 4 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lepA PE=3 SV=1 129 311 1.0E-15
sp|Q7NGX4|LEPA_GLOVI Elongation factor 4 OS=Gloeobacter violaceus (strain PCC 7421) GN=lepA PE=3 SV=1 129 269 1.0E-15
sp|B2U978|LEPA_RALPJ Elongation factor 4 OS=Ralstonia pickettii (strain 12J) GN=lepA PE=3 SV=1 131 320 1.0E-15
sp|Q21BS0|LEPA_RHOPB Elongation factor 4 OS=Rhodopseudomonas palustris (strain BisB18) GN=lepA PE=3 SV=2 131 269 1.0E-15
sp|Q5VQ69|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0144800 PE=3 SV=1 127 270 1.0E-15
sp|O07631|TYPA_BACSU GTP-binding protein TypA/BipA homolog OS=Bacillus subtilis (strain 168) GN=typA PE=3 SV=1 124 270 1.0E-15
sp|A8FSD4|LEPA_SHESH Elongation factor 4 OS=Shewanella sediminis (strain HAW-EB3) GN=lepA PE=3 SV=1 128 269 1.0E-15
sp|B3RXR7|GUF1_TRIAD Translation factor GUF1 homolog, mitochondrial OS=Trichoplax adhaerens GN=TRIADDRAFT_56304 PE=3 SV=1 123 269 1.0E-15
sp|P74228|EFG2_SYNY3 Elongation factor G 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusB PE=3 SV=1 422 920 1.0E-15
sp|A4J7F8|LEPA_DESRM Elongation factor 4 OS=Desulfotomaculum reducens (strain MI-1) GN=lepA PE=3 SV=1 124 269 1.0E-15
sp|B8B2R1|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_21607 PE=3 SV=1 127 270 1.0E-15
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 128 269 1.0E-15
sp|B9MJZ5|LEPA_CALBD Elongation factor 4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lepA PE=3 SV=1 129 269 1.0E-15
sp|Q92BN4|LEPA_LISIN Elongation factor 4 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lepA PE=3 SV=1 124 307 1.0E-15
sp|Q82BZ3|LEPA_STRAW Elongation factor 4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=lepA PE=3 SV=1 127 269 1.0E-15
sp|Q6NJD6|EFG_CORDI Elongation factor G OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=fusA PE=3 SV=2 128 294 2.0E-15
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 128 294 4.0E-15
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 128 294 4.0E-15
sp|Q8NT19|EFG_CORGL Elongation factor G OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=fusA PE=3 SV=1 128 271 5.0E-15
sp|A4QBG9|EFG_CORGB Elongation factor G OS=Corynebacterium glutamicum (strain R) GN=fusA PE=3 SV=1 128 271 5.0E-15
sp|Q118Z3|EFG1_TRIEI Elongation factor G 1 OS=Trichodesmium erythraeum (strain IMS101) GN=fusA1 PE=3 SV=1 128 270 6.0E-15
sp|Q8DI43|EFG_THEEB Elongation factor G OS=Thermosynechococcus elongatus (strain BP-1) GN=fusA PE=3 SV=1 128 270 2.0E-14
sp|C1AYS4|EFG_RHOOB Elongation factor G OS=Rhodococcus opacus (strain B4) GN=fusA PE=3 SV=1 128 294 2.0E-14
sp|Q0SFF3|EFG_RHOJR Elongation factor G OS=Rhodococcus jostii (strain RHA1) GN=fusA PE=3 SV=1 128 294 2.0E-14
sp|C0ZVT6|EFG_RHOE4 Elongation factor G OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=fusA PE=3 SV=1 128 294 2.0E-14
sp|Q8FS85|EFG_COREF Elongation factor G OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=fusA PE=3 SV=2 128 271 3.0E-14
sp|B1VET0|EFG_CORU7 Elongation factor G OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=fusA PE=3 SV=1 128 271 3.0E-14
sp|C5D3R4|EFG_GEOSW Elongation factor G OS=Geobacillus sp. (strain WCH70) GN=fusA PE=3 SV=1 128 271 5.0E-14
sp|Q5WLR5|EFG_BACSK Elongation factor G OS=Bacillus clausii (strain KSM-K16) GN=fusA PE=3 SV=1 128 270 5.0E-14
sp|A8LC59|EFG_FRASN Elongation factor G OS=Frankia sp. (strain EAN1pec) GN=fusA PE=3 SV=1 130 275 8.0E-14
sp|Q0RRS4|EFG_FRAAA Elongation factor G OS=Frankia alni (strain ACN14a) GN=fusA PE=3 SV=1 130 275 8.0E-14
sp|Q1BDD4|EFG_MYCSS Elongation factor G OS=Mycobacterium sp. (strain MCS) GN=fusA PE=3 SV=1 122 294 9.0E-14
sp|A1UBL0|EFG_MYCSK Elongation factor G OS=Mycobacterium sp. (strain KMS) GN=fusA PE=3 SV=1 122 294 9.0E-14
sp|A3PV95|EFG_MYCSJ Elongation factor G OS=Mycobacterium sp. (strain JLS) GN=fusA PE=3 SV=1 122 294 9.0E-14
sp|P74228|EFG2_SYNY3 Elongation factor G 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusB PE=3 SV=1 128 270 2.0E-13
sp|A4FPM8|EFG_SACEN Elongation factor G OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=fusA PE=3 SV=1 122 271 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0032561 guanyl ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4532
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2517
Ophiocordyceps australis map64 (Brazil) OphauB2|1539 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01032
Ophiocordyceps camponoti-rufipedis Ophun1|6087
Ophiocordyceps kimflemingae Ophio5|2726
Ophiocordyceps subramaniannii Hirsu2|9473

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1539
MDDLYDEFGNFIGDDAASDEVSDAGVNADDYVYDDEPDQEGEAGGELMEIDEGPSNAVVLHEDKQYYPTAEQVYG
PDVETRVEEEDAQPLTEPIIAPVEVKRFNIEEANLPHVFFDRTFMMDLMNFPQQTRNVALAGHLHHGKTAFMDML
VMQTHDMADRLDKRTGRKREEEVRYTDIHLVERERGLSVKAAPMSLVLQSSKGKSHLVNLIDTPGHVNFVDEVAA
AFRLVDGVCLVVDVVEGVQVNTEQIIKHAVLEDVPLTLVINKMDRLILELKLPPKDAYFKLKHVVEEVNTVITNT
APASAASRRISPEKGNVLFACTDLGWCFTLESFAKMYVDSYGGVNVSDFAKRLWGDVYFNPTKRNFSRKPMESAA
ARSFLYFVLEPVYKIFTHSISDSPAKLSRVLASLGIQLKPWQYKADAKTILKLVCEQFFGSSTGFVDMILQHVPS
PVEASEHLLQRYYTGPLDTKVANSIKTCDADGPLVIHVTKLFSSSDAKSFYSFGRVLSGTARPGMSVRVLGEGYS
VDDDEDMTTATIDQVLIAETRYNIATDGVPAGNLVLMSGVDNSIVKSATIMATKLDEDEEAHIFRPVTHFTQSVL
KVAVEPINPSELPKMLDGLRKIQKSYPLIDTKVEESGEHIVLGTGELYMDCVLHDLRRLYADMDIKVSDPVTRFC
ETVVETSATKCYAITPNKKNKITMVAEQLEKGIATDIETGAVKIRDPIRKTAKFFEEHHGWDKLAARSIWAFGPE
DKGTNILQDDTLPTEIDKKLLGTVRESIRQGFSWATREGPLCEEPIRNTRFKVTDVALAAEAIYRGGGQIIPTSR
RACYSSFLMASPRLMEPVYAVSVTGPEDSYMEVYNVLARRRGHVLSDGPVAGTPLYRVNGLVPVIDSFGFETDLR
IKTQGASMVSMVFDSWSIVPGDPLDKEQVLRPLQPATTQATARDFVLKTRRRKGLSEDVSVKTFLEPEFYQSLME
SGMLGDM*
Coding >OphauB2|1539
ATGGATGACCTCTACGACGAGTTTGGGAATTTTATTGGCGACGATGCCGCTTCCGACGAGGTATCGGACGCGGGC
GTCAACGCGGACGACTATGTCTATGACGACGAGCCCGACCAAGAAGGCGAAGCTGGCGGCGAGCTGATGGAGATT
GATGAGGGACCTTCGAATGCCGTTGTTCTTCACGAGGATAAACAGTACTACCCCACGGCCGAGCAGGTGTACGGT
CCCGATGTCGAGACGCGGGTCGAAGAGGAAGACGCACAGCCGCTGACGGAGCCCATTATCGCGCCCGTCGAGGTG
AAGCGCTTCAACATTGAGGAGGCGAATCTGCCCCATGTCTTCTTTGACCGCACCTTCATGATGGACTTGATGAAC
TTTCCGCAGCAGACGCGAAATGTGGCCTTGGCTGGGCATTTGCACCACGGCAAGACGGCCTTTATGGACATGCTC
GTCATGCAGACTCACGACATGGCTGATCGCTTGGACAAGCGGACCGGGCGCAAGCGCGAAGAAGAGGTGCGCTAC
ACAGATATCCACCTGGTGGAGCGCGAACGAGGTCTCTCGGTCAAGGCGGCGCCCATGAGTCTTGTGCTGCAGAGC
TCCAAGGGCAAGTCGCACCTGGTCAATCTCATTGATACGCCGGGACATGTCAACTTTGTCGACGAGGTGGCGGCG
GCCTTTCGCTTGGTGGACGGCGTGTGCCTAGTGGTTGATGTGGTGGAAGGCGTGCAAGTCAATACGGAGCAAATC
ATCAAGCATGCCGTGCTCGAGGACGTCCCCCTGACGCTCGTCATCAACAAGATGGACCGCTTGATCCTGGAGCTC
AAGCTGCCGCCCAAGGACGCCTACTTTAAGCTCAAGCACGTGGTTGAGGAAGTCAATACCGTTATTACCAATACG
GCGCCTGCATCGGCAGCATCGAGACGCATAAGCCCTGAAAAGGGCAACGTGCTATTTGCCTGTACCGATCTGGGC
TGGTGTTTTACGCTGGAGTCGTTTGCCAAGATGTACGTCGACAGCTATGGCGGCGTCAATGTCTCAGACTTTGCC
AAGCGATTATGGGGCGACGTCTACTTCAACCCTACCAAGCGCAACTTTTCGCGCAAGCCCATGGAAAGCGCAGCT
GCTCGGTCTTTTCTCTACTTTGTCCTCGAGCCCGTTTACAAGATTTTCACGCATTCTATTAGCGACAGTCCTGCT
AAGCTGAGTCGAGTCTTGGCCTCGCTGGGTATCCAGCTCAAGCCCTGGCAGTACAAGGCGGATGCAAAGACGATT
TTGAAGCTGGTGTGCGAGCAATTCTTTGGTTCTAGCACCGGCTTTGTCGACATGATTTTGCAGCACGTTCCGTCT
CCGGTGGAAGCCTCGGAGCACCTTTTGCAACGATATTACACTGGCCCGCTGGATACCAAGGTTGCCAACTCTATA
AAGACGTGCGATGCAGACGGGCCTCTGGTAATACATGTAACCAAGCTTTTTAGCTCTTCGGATGCAAAGAGCTTC
TATTCCTTTGGTCGGGTGCTCAGCGGCACTGCGCGGCCGGGCATGAGCGTGCGCGTCCTGGGCGAGGGCTATTCG
GTCGACGACGACGAAGACATGACGACGGCAACCATTGACCAAGTCTTGATTGCCGAGACACGGTACAATATTGCC
ACAGACGGCGTGCCGGCTGGCAATTTGGTGCTCATGAGCGGCGTAGACAATTCCATTGTCAAATCGGCCACCATT
ATGGCCACCAAGTTGGACGAGGACGAGGAGGCGCACATCTTTCGGCCCGTGACGCACTTTACCCAGTCGGTGCTC
AAGGTGGCAGTGGAGCCCATTAATCCGTCTGAACTGCCCAAGATGCTTGACGGCCTGCGCAAGATTCAAAAGTCG
TACCCCCTCATCGACACCAAGGTGGAGGAGTCTGGGGAGCACATTGTCCTGGGCACCGGCGAGCTCTACATGGAC
TGCGTCTTGCACGACTTGCGCCGCCTGTATGCAGACATGGACATCAAGGTGTCTGATCCTGTGACGCGCTTCTGC
GAGACAGTTGTCGAGACGTCTGCCACCAAGTGCTATGCCATTACACCCAACAAGAAAAACAAGATTACCATGGTG
GCGGAGCAGTTGGAAAAGGGCATTGCCACTGACATCGAGACGGGTGCTGTCAAGATTCGGGATCCGATTCGGAAA
ACGGCCAAATTCTTTGAGGAGCATCATGGCTGGGACAAGCTTGCAGCAAGGAGCATATGGGCCTTTGGGCCCGAG
GACAAGGGCACAAACATTTTGCAGGACGACACGTTGCCGACCGAGATTGACAAGAAACTCCTCGGCACGGTCCGC
GAGTCGATCCGACAGGGGTTCAGCTGGGCCACGCGTGAGGGGCCCTTGTGTGAAGAGCCAATTCGAAACACTAGA
TTCAAAGTAACAGACGTGGCACTGGCAGCAGAGGCCATCTACCGCGGTGGGGGACAAATCATTCCCACGTCTCGA
CGAGCATGCTATTCGTCCTTTCTCATGGCCTCGCCGCGGCTAATGGAGCCCGTCTACGCTGTATCTGTCACGGGG
CCCGAGGATTCCTACATGGAGGTGTACAATGTGCTGGCACGGCGGCGCGGGCACGTCTTGTCTGACGGCCCTGTG
GCAGGCACGCCGCTGTACCGGGTGAATGGGCTGGTGCCCGTCATTGACAGCTTTGGCTTTGAAACAGACTTGCGA
ATCAAGACACAGGGGGCATCCATGGTGAGCATGGTTTTCGATAGCTGGAGCATAGTGCCAGGCGATCCTCTGGAC
AAGGAGCAGGTGCTGCGGCCGTTGCAGCCAGCAACGACACAGGCAACGGCTCGCGACTTTGTTCTCAAGACTAGG
AGACGAAAGGGGTTGAGTGAAGATGTAAGCGTAAAGACGTTTTTGGAGCCCGAGTTTTATCAGAGTTTGATGGAG
AGTGGCATGTTGGGGGATATGTGA
Transcript >OphauB2|1539
ATGGATGACCTCTACGACGAGTTTGGGAATTTTATTGGCGACGATGCCGCTTCCGACGAGGTATCGGACGCGGGC
GTCAACGCGGACGACTATGTCTATGACGACGAGCCCGACCAAGAAGGCGAAGCTGGCGGCGAGCTGATGGAGATT
GATGAGGGACCTTCGAATGCCGTTGTTCTTCACGAGGATAAACAGTACTACCCCACGGCCGAGCAGGTGTACGGT
CCCGATGTCGAGACGCGGGTCGAAGAGGAAGACGCACAGCCGCTGACGGAGCCCATTATCGCGCCCGTCGAGGTG
AAGCGCTTCAACATTGAGGAGGCGAATCTGCCCCATGTCTTCTTTGACCGCACCTTCATGATGGACTTGATGAAC
TTTCCGCAGCAGACGCGAAATGTGGCCTTGGCTGGGCATTTGCACCACGGCAAGACGGCCTTTATGGACATGCTC
GTCATGCAGACTCACGACATGGCTGATCGCTTGGACAAGCGGACCGGGCGCAAGCGCGAAGAAGAGGTGCGCTAC
ACAGATATCCACCTGGTGGAGCGCGAACGAGGTCTCTCGGTCAAGGCGGCGCCCATGAGTCTTGTGCTGCAGAGC
TCCAAGGGCAAGTCGCACCTGGTCAATCTCATTGATACGCCGGGACATGTCAACTTTGTCGACGAGGTGGCGGCG
GCCTTTCGCTTGGTGGACGGCGTGTGCCTAGTGGTTGATGTGGTGGAAGGCGTGCAAGTCAATACGGAGCAAATC
ATCAAGCATGCCGTGCTCGAGGACGTCCCCCTGACGCTCGTCATCAACAAGATGGACCGCTTGATCCTGGAGCTC
AAGCTGCCGCCCAAGGACGCCTACTTTAAGCTCAAGCACGTGGTTGAGGAAGTCAATACCGTTATTACCAATACG
GCGCCTGCATCGGCAGCATCGAGACGCATAAGCCCTGAAAAGGGCAACGTGCTATTTGCCTGTACCGATCTGGGC
TGGTGTTTTACGCTGGAGTCGTTTGCCAAGATGTACGTCGACAGCTATGGCGGCGTCAATGTCTCAGACTTTGCC
AAGCGATTATGGGGCGACGTCTACTTCAACCCTACCAAGCGCAACTTTTCGCGCAAGCCCATGGAAAGCGCAGCT
GCTCGGTCTTTTCTCTACTTTGTCCTCGAGCCCGTTTACAAGATTTTCACGCATTCTATTAGCGACAGTCCTGCT
AAGCTGAGTCGAGTCTTGGCCTCGCTGGGTATCCAGCTCAAGCCCTGGCAGTACAAGGCGGATGCAAAGACGATT
TTGAAGCTGGTGTGCGAGCAATTCTTTGGTTCTAGCACCGGCTTTGTCGACATGATTTTGCAGCACGTTCCGTCT
CCGGTGGAAGCCTCGGAGCACCTTTTGCAACGATATTACACTGGCCCGCTGGATACCAAGGTTGCCAACTCTATA
AAGACGTGCGATGCAGACGGGCCTCTGGTAATACATGTAACCAAGCTTTTTAGCTCTTCGGATGCAAAGAGCTTC
TATTCCTTTGGTCGGGTGCTCAGCGGCACTGCGCGGCCGGGCATGAGCGTGCGCGTCCTGGGCGAGGGCTATTCG
GTCGACGACGACGAAGACATGACGACGGCAACCATTGACCAAGTCTTGATTGCCGAGACACGGTACAATATTGCC
ACAGACGGCGTGCCGGCTGGCAATTTGGTGCTCATGAGCGGCGTAGACAATTCCATTGTCAAATCGGCCACCATT
ATGGCCACCAAGTTGGACGAGGACGAGGAGGCGCACATCTTTCGGCCCGTGACGCACTTTACCCAGTCGGTGCTC
AAGGTGGCAGTGGAGCCCATTAATCCGTCTGAACTGCCCAAGATGCTTGACGGCCTGCGCAAGATTCAAAAGTCG
TACCCCCTCATCGACACCAAGGTGGAGGAGTCTGGGGAGCACATTGTCCTGGGCACCGGCGAGCTCTACATGGAC
TGCGTCTTGCACGACTTGCGCCGCCTGTATGCAGACATGGACATCAAGGTGTCTGATCCTGTGACGCGCTTCTGC
GAGACAGTTGTCGAGACGTCTGCCACCAAGTGCTATGCCATTACACCCAACAAGAAAAACAAGATTACCATGGTG
GCGGAGCAGTTGGAAAAGGGCATTGCCACTGACATCGAGACGGGTGCTGTCAAGATTCGGGATCCGATTCGGAAA
ACGGCCAAATTCTTTGAGGAGCATCATGGCTGGGACAAGCTTGCAGCAAGGAGCATATGGGCCTTTGGGCCCGAG
GACAAGGGCACAAACATTTTGCAGGACGACACGTTGCCGACCGAGATTGACAAGAAACTCCTCGGCACGGTCCGC
GAGTCGATCCGACAGGGGTTCAGCTGGGCCACGCGTGAGGGGCCCTTGTGTGAAGAGCCAATTCGAAACACTAGA
TTCAAAGTAACAGACGTGGCACTGGCAGCAGAGGCCATCTACCGCGGTGGGGGACAAATCATTCCCACGTCTCGA
CGAGCATGCTATTCGTCCTTTCTCATGGCCTCGCCGCGGCTAATGGAGCCCGTCTACGCTGTATCTGTCACGGGG
CCCGAGGATTCCTACATGGAGGTGTACAATGTGCTGGCACGGCGGCGCGGGCACGTCTTGTCTGACGGCCCTGTG
GCAGGCACGCCGCTGTACCGGGTGAATGGGCTGGTGCCCGTCATTGACAGCTTTGGCTTTGAAACAGACTTGCGA
ATCAAGACACAGGGGGCATCCATGGTGAGCATGGTTTTCGATAGCTGGAGCATAGTGCCAGGCGATCCTCTGGAC
AAGGAGCAGGTGCTGCGGCCGTTGCAGCCAGCAACGACACAGGCAACGGCTCGCGACTTTGTTCTCAAGACTAGG
AGACGAAAGGGGTTGAGTGAAGATGTAAGCGTAAAGACGTTTTTGGAGCCCGAGTTTTATCAGAGTTTGATGGAG
AGTGGCATGTTGGGGGATATGTGA
Gene >OphauB2|1539
ATGGATGACCTCTACGACGAGTGAGAGCAGCCAATGCTTTACATGTGCGCTGCAGTCACTAATGTCGCGAGTCTA
GGTTTGGGAATTTTATTGGCGACGATGCCGCTTCCGACGAGGTATCGGACGCGGGCGTCAACGCGGACGACTATG
TCTATGACGACGAGCCCGACCAAGAAGGCGAAGCTGGCGGCGAGCTGATGGAGATTGATGGTGCGTGGCAGTGGC
CCGAGACCCGACGAAGCAGACTGACAAGTCTGCTTTAGAGGGACCTTCGAATGCCGTTGTTCTTCACGAGGATAA
ACAGTACTACCCCACGGCCGAGCAGGTGTACGGTCCCGATGTCGAGACGCGGGTCGAAGAGGAAGACGCACAGCC
GCTGACGGAGCCCATTATCGCGCCCGTCGAGGTGAAGCGCTTCAACATTGAGGAGGCGAATCTGCCCCATGTCTT
CTTTGACCGCACCTTCATGATGGACTTGATGAACTTTCCGCAGCAGACGCGAAATGTGGCCTTGGCTGGGCATTT
GCACCACGGCAAGACGGCCTTTATGGACATGCTCGTCATGCAGACTCACGACATGGCTGATCGCTTGGACAAGCG
GACCGGGCGCAAGCGCGAAGAAGAGGTGCGCTACACAGATATCCACCTGGTGGAGCGCGAACGAGGTCTCTCGGT
CAAGGCGGCGCCCATGAGTCTTGTGCTGCAGAGCTCCAAGGGCAAGTCGCACCTGGTCAATCTCATTGATACGCC
GGGACATGTCAACTTTGTCGACGAGGTGGCGGCGGCCTTTCGCTTGGTGGACGGCGTGTGCCTAGTGGTTGATGT
GGTGGAAGGCGTGCAAGTCAATACGGAGCAAATCATCAAGCATGCCGTGCTCGAGGACGTCCCCCTGACGCTCGT
CATCAACAAGATGGACCGCTTGATCCTGGAGCTCAAGCTGCCGCCCAAGGACGCCTACTTTAAGCTCAAGCACGT
GGTTGAGGAAGTCAATACCGTTATTACCAATACGGCGCCTGCATCGGCAGCATCGAGACGCATAAGCCCTGAAAA
GGGCAACGTGCTATTTGCCTGTACCGATCTGGGCTGGTGTTTTACGCTGGAGTCGTTTGCCAAGATGTACGTCGA
CAGCTATGGCGGCGTCAATGTCTCAGACTTTGCCAAGCGATTATGGGGCGACGTCTACTTCAACCCTACCAAGCG
CAACTTTTCGCGCAAGCCCATGGAAAGCGCAGCTGCTCGGTCTTTTCTCTACTTTGTCCTCGAGCCCGTTTACAA
GATTTTCACGCATTCTATTAGCGACAGTCCTGCTAAGCTGAGTCGAGTCTTGGCCTCGCTGGGTATCCAGCTCAA
GCCCTGGCAGTACAAGGCGGATGCAAAGACGATTTTGAAGCTGGTGTGCGAGCAATTCTTTGGTTCTAGCACCGG
CTTTGTCGACATGATTTTGCAGCACGTTCCGTCTCCGGTGGAAGCCTCGGAGCACCTTTTGCAACGATATTACAC
TGGCCCGCTGGATACCAAGGTTGCCAACTCTATAAAGACGTGCGATGCAGACGGGCCTCTGGTAATACATGTAAC
CAAGCTTTTTAGCTCTTCGGATGCAAAGAGCTTCTATTCCTTTGGTCGGGTGCTCAGCGGCACTGCGCGGCCGGG
CATGAGCGTGCGCGTCCTGGGCGAGGGCTATTCGGTCGACGACGACGAAGACATGACGACGGCAACCATTGACCA
AGTCTTGATTGCCGAGACACGGTACAATATTGCCACAGACGGCGTGCCGGCTGGCAATTTGGTGCTCATGAGCGG
CGTAGACAATTCCATTGTCAAATCGGCCACCATTATGGCCACCAAGTTGGACGAGGACGAGGAGGCGCACATCTT
TCGGCCCGTGACGCACTTTACCCAGTCGGTGCTCAAGGTGGCAGTGGAGCCCATTAATCCGTCTGAACTGCCCAA
GATGCTTGACGGCCTGCGCAAGATTCAAAAGTCGTACCCCCTCATCGACACCAAGGTGGAGGAGTCTGGGGAGCA
CATTGTCCTGGGCACCGGCGAGCTCTACATGGACTGCGTCTTGCACGACTTGCGCCGCCTGTATGCAGACATGGA
CATCAAGGTGTCTGATCCTGTGACGCGCTTCTGCGAGACAGTTGTCGAGACGTCTGCCACCAAGTGCTATGCCAT
TACACCCAACAAGAAAAACAAGATTACCATGGTGGCGGAGCAGTTGGAAAAGGGCATTGCCACTGACATCGAGAC
GGGTGCTGTCAAGATTCGGGATCCGATTCGGAAAACGGCCAAATTCTTTGAGGAGCATCATGGCTGGGACAAGCT
TGCAGCAAGGAGCATATGGGCCTTTGGGCCCGAGGACAAGGGCACAAACATTTTGCAGGACGACACGTTGCCGAC
CGAGGTAGCTGAAATTTTTTTTTTCCGAATTGGAGTTTCATAATTGGCTGCTGACTGTTTGAAACAGATTGACAA
GAAACTCCTCGGCACGGTCCGCGAGTCGATCCGACAGGGGTTCAGCTGGGCCACGCGTGAGGGGCCCTTGTGTGA
AGAGCGTGAGTCGCCTTGTTGTAAACAAAGGGCATTGACTGGGCTAATTTGTCATGGCGGCTTATGTGTAGCAAT
TCGAAACACTAGATTCAAAGTAACAGACGTGGCACTGGCAGCAGAGGCCATCTACCGCGGTGGGGGACAAATCAT
TCCCACGTCTCGACGAGCATGCTATTCGTCCTTTCTCATGGCCTCGCCGCGGCTAATGGAGCCCGTCTACGCTGT
ATCTGTCACGGGGCCCGAGGATTCCTACATGGAGGTGTACAATGTGCTGGCACGGCGGCGCGGGCACGTCTTGTC
TGACGGCCCTGTGGCAGGCACGCCGCTGTACCGGGTGAATGGGCTGGTGCCCGTCATTGACAGCTTTGGCTTTGA
AACAGACTTGCGAATCAAGACACAGGGGGCATCCATGGTGAGCATGGTTTTCGATAGCTGGAGCATAGTGCCAGG
CGATCCTCTGGACAAGGAGCAGGTGCTGCGGCCGTTGCAGCCAGCAACGACACAGGCAACGGCTCGCGACTTTGT
TCTCAAGACTAGGAGACGAAAGGGGTTGAGTGAAGATGTAAGCGTAAAGACGTTTTTGGAGCCCGAGTTTTATCA
GAGTTTGATGGAGAGTGGCATGTTGGGGGATATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail