Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1537
Gene name
LocationContig_140:8998..9631
Strand+
Gene length (bp)633
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein 7.8E-07 56 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38829|YHS2_YEAST MIP18 family protein YHR122W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR122W PE=1 SV=1 51 185 8.0E-50
sp|Q9UTL0|YIVG_SCHPO MIP18 family protein C144.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.16 PE=3 SV=1 2 186 7.0E-44
sp|Q9VTC4|U195A_DROME MIP18 family protein CG7949 OS=Drosophila melanogaster GN=CG7949 PE=1 SV=1 38 180 5.0E-32
sp|Q9C9G6|AE7_ARATH Protein AE7 OS=Arabidopsis thaliana GN=AE7 PE=1 SV=2 50 182 2.0E-31
sp|A8MR89|AEL1_ARATH Protein AE7-like 1 OS=Arabidopsis thaliana GN=AEL1 PE=3 SV=1 43 180 8.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38829|YHS2_YEAST MIP18 family protein YHR122W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR122W PE=1 SV=1 51 185 8.0E-50
sp|Q9UTL0|YIVG_SCHPO MIP18 family protein C144.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.16 PE=3 SV=1 2 186 7.0E-44
sp|Q9VTC4|U195A_DROME MIP18 family protein CG7949 OS=Drosophila melanogaster GN=CG7949 PE=1 SV=1 38 180 5.0E-32
sp|Q9C9G6|AE7_ARATH Protein AE7 OS=Arabidopsis thaliana GN=AE7 PE=1 SV=2 50 182 2.0E-31
sp|A8MR89|AEL1_ARATH Protein AE7-like 1 OS=Arabidopsis thaliana GN=AEL1 PE=3 SV=1 43 180 8.0E-31
sp|Q9D187|MIP18_MOUSE Mitotic spindle-associated MMXD complex subunit MIP18 OS=Mus musculus GN=Fam96b PE=1 SV=1 51 182 2.0E-30
sp|Q9Y3D0|MIP18_HUMAN Mitotic spindle-associated MMXD complex subunit MIP18 OS=Homo sapiens GN=FAM96B PE=1 SV=1 45 182 3.0E-30
sp|O62252|U195_CAEEL MIP18 family protein F45G2.10 OS=Caenorhabditis elegans GN=F45G2.10 PE=1 SV=1 4 182 7.0E-30
sp|Q54QK1|FA96B_DICDI MIP18 family protein FAM96B OS=Dictyostelium discoideum GN=fam96B PE=3 SV=2 40 173 6.0E-28
sp|Q9V968|U195B_DROME MIP18 family protein CG30152 OS=Drosophila melanogaster GN=CG30152 PE=1 SV=1 37 179 5.0E-27
sp|Q9DCL2|FA96A_MOUSE MIP18 family protein FAM96A OS=Mus musculus GN=Fam96a PE=1 SV=1 47 180 1.0E-26
sp|Q9H5X1|FA96A_HUMAN MIP18 family protein FAM96A OS=Homo sapiens GN=FAM96A PE=1 SV=1 58 180 5.0E-26
sp|Q3T0U7|FA96A_BOVIN MIP18 family protein FAM96A OS=Bos taurus GN=FAM96A PE=2 SV=1 58 180 1.0E-25
sp|Q9SR25|AEL2_ARATH Protein AE7-like 2 OS=Arabidopsis thaliana GN=AEL2 PE=2 SV=2 55 185 2.0E-23
sp|Q9GPR0|FA96A_DICDI MIP18 family protein FAM96A OS=Dictyostelium discoideum GN=fam96A PE=3 SV=1 54 183 2.0E-17
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4354
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2519
Ophiocordyceps australis map64 (Brazil) OphauB2|1537 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01030
Ophiocordyceps camponoti-rufipedis Ophun1|6089
Ophiocordyceps kimflemingae Ophio5|4557
Ophiocordyceps subramaniannii Hirsu2|8955

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1537
MAALDNANPTILSASQLPTRHCKASPRCGPDTIYNDVVFGDNVQDDSTYAPEPIDEQEIYDLISSISDPEHPVSL
GQLSVVNLDDIHLDPPPAQHSANPNAIIQVVVDITPTITHCSLATVIGLGVRARLEQCLPPNYRVDVRCKANSHT
QDEQVNKQLADKERVAAALENDSLRAVLDKMLETCA*
Coding >OphauB2|1537
ATGGCTGCCCTCGACAACGCCAACCCCACCATCCTCAGCGCATCCCAGCTGCCCACCCGCCACTGCAAGGCTTCT
CCCCGCTGCGGACCCGACACCATCTACAACGACGTCGTTTTTGGTGACAATGTGCAAGACGACTCCACGTATGCG
CCCGAGCCCATAGACGAGCAGGAAATCTACGACCTCATCTCTTCCATCTCAGACCCCGAACACCCCGTCTCTCTT
GGCCAGCTCTCTGTTGTCAACCTCGACGACATTCATCTCGACCCCCCTCCTGCCCAGCACTCGGCCAACCCCAAC
GCCATTATCCAGGTCGTCGTGGACATTACCCCAACCATTACCCACTGCAGCCTTGCCACCGTTATTGGTCTCGGC
GTCCGCGCCCGTCTGGAGCAATGCCTCCCGCCAAACTACCGCGTCGACGTGCGCTGCAAGGCAAACTCGCACACC
CAAGACGAGCAAGTCAATAAACAGCTCGCCGATAAGGAACGCGTCGCCGCCGCCCTTGAAAACGACTCTCTCCGC
GCCGTCTTGGACAAGATGCTCGAGACATGTGCCTGA
Transcript >OphauB2|1537
ATGGCTGCCCTCGACAACGCCAACCCCACCATCCTCAGCGCATCCCAGCTGCCCACCCGCCACTGCAAGGCTTCT
CCCCGCTGCGGACCCGACACCATCTACAACGACGTCGTTTTTGGTGACAATGTGCAAGACGACTCCACGTATGCG
CCCGAGCCCATAGACGAGCAGGAAATCTACGACCTCATCTCTTCCATCTCAGACCCCGAACACCCCGTCTCTCTT
GGCCAGCTCTCTGTTGTCAACCTCGACGACATTCATCTCGACCCCCCTCCTGCCCAGCACTCGGCCAACCCCAAC
GCCATTATCCAGGTCGTCGTGGACATTACCCCAACCATTACCCACTGCAGCCTTGCCACCGTTATTGGTCTCGGC
GTCCGCGCCCGTCTGGAGCAATGCCTCCCGCCAAACTACCGCGTCGACGTGCGCTGCAAGGCAAACTCGCACACC
CAAGACGAGCAAGTCAATAAACAGCTCGCCGATAAGGAACGCGTCGCCGCCGCCCTTGAAAACGACTCTCTCCGC
GCCGTCTTGGACAAGATGCTCGAGACATGTGCCTGA
Gene >OphauB2|1537
ATGGCTGCCCTCGACAACGCCAACCCCACCATCCTCAGCGCATCCCAGCTGCCCACCCGCCACTGCAAGGCTTCT
CCCCGCTGCGGACCCGACACCATCTACAACGACGTCGTTTTTGGTGACAATGTGCAAGACGACTCCACGTATGCG
CCCGAGCCCATAGACGAGCAGGAAATCTACGGTTTGAGCCCCCCCCCCTCCTTGTGCAGTCGGCATGTGCCATGA
AGCAACTAATTGTCTTGCTGTCCTCTAGACCTCATCTCTTCCATCTCAGACCCCGAACACCCCGTCTCTCTTGGC
CAGCTCTCTGTTGTCAACCTCGACGACATTCATCTCGACCCCCCTCCTGCCCAGCACTCGGCCAACCCCAACGCC
ATTATCCAGGTCGTCGTGGACATTACCCCAACCATTACCCACTGCAGCCTTGCCACCGTTATTGGTCTCGGCGTC
CGCGCCCGTCTGGAGCAATGCCTCCCGCCAAACTACCGCGTCGACGTGCGCTGCAAGGCAAACTCGCACACCCAA
GACGAGCAAGTCAATAAACAGCTCGCCGATAAGGAACGCGTCGCCGCCGCCCTTGAAAACGACTCTCTCCGCGCC
GTCTTGGACAAGATGCTCGAGACATGTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail