Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1537
Gene name
LocationContig_140:8998..9631
Strand+
Gene length (bp)633
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein 7.8E-07 56 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38829|YHS2_YEAST MIP18 family protein YHR122W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR122W PE=1 SV=1 51 185 8.0E-50
sp|Q9UTL0|YIVG_SCHPO MIP18 family protein C144.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.16 PE=3 SV=1 2 186 7.0E-44
sp|Q9VTC4|U195A_DROME MIP18 family protein CG7949 OS=Drosophila melanogaster GN=CG7949 PE=1 SV=1 38 180 5.0E-32
sp|Q9C9G6|AE7_ARATH Protein AE7 OS=Arabidopsis thaliana GN=AE7 PE=1 SV=2 50 182 2.0E-31
sp|A8MR89|AEL1_ARATH Protein AE7-like 1 OS=Arabidopsis thaliana GN=AEL1 PE=3 SV=1 43 180 8.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38829|YHS2_YEAST MIP18 family protein YHR122W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR122W PE=1 SV=1 51 185 8.0E-50
sp|Q9UTL0|YIVG_SCHPO MIP18 family protein C144.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.16 PE=3 SV=1 2 186 7.0E-44
sp|Q9VTC4|U195A_DROME MIP18 family protein CG7949 OS=Drosophila melanogaster GN=CG7949 PE=1 SV=1 38 180 5.0E-32
sp|Q9C9G6|AE7_ARATH Protein AE7 OS=Arabidopsis thaliana GN=AE7 PE=1 SV=2 50 182 2.0E-31
sp|A8MR89|AEL1_ARATH Protein AE7-like 1 OS=Arabidopsis thaliana GN=AEL1 PE=3 SV=1 43 180 8.0E-31
sp|Q9D187|MIP18_MOUSE Mitotic spindle-associated MMXD complex subunit MIP18 OS=Mus musculus GN=Fam96b PE=1 SV=1 51 182 2.0E-30
sp|Q9Y3D0|MIP18_HUMAN Mitotic spindle-associated MMXD complex subunit MIP18 OS=Homo sapiens GN=FAM96B PE=1 SV=1 45 182 3.0E-30
sp|O62252|U195_CAEEL MIP18 family protein F45G2.10 OS=Caenorhabditis elegans GN=F45G2.10 PE=1 SV=1 4 182 7.0E-30
sp|Q54QK1|FA96B_DICDI MIP18 family protein FAM96B OS=Dictyostelium discoideum GN=fam96B PE=3 SV=2 40 173 6.0E-28
sp|Q9V968|U195B_DROME MIP18 family protein CG30152 OS=Drosophila melanogaster GN=CG30152 PE=1 SV=1 37 179 5.0E-27
sp|Q9DCL2|FA96A_MOUSE MIP18 family protein FAM96A OS=Mus musculus GN=Fam96a PE=1 SV=1 47 180 1.0E-26
sp|Q9H5X1|FA96A_HUMAN MIP18 family protein FAM96A OS=Homo sapiens GN=FAM96A PE=1 SV=1 58 180 5.0E-26
sp|Q3T0U7|FA96A_BOVIN MIP18 family protein FAM96A OS=Bos taurus GN=FAM96A PE=2 SV=1 58 180 1.0E-25
sp|Q9SR25|AEL2_ARATH Protein AE7-like 2 OS=Arabidopsis thaliana GN=AEL2 PE=2 SV=2 55 185 2.0E-23
sp|Q9GPR0|FA96A_DICDI MIP18 family protein FAM96A OS=Dictyostelium discoideum GN=fam96A PE=3 SV=1 54 183 2.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1537
MAALDNANPTILSASQLPTRHCKASPRCGPDTIYNDVVFGDNVQDDSTYAPEPIDEQEIYDLISSISDPEHPVSL
GQLSVVNLDDIHLDPPPAQHSANPNAIIQVVVDITPTITHCSLATVIGLGVRARLEQCLPPNYRVDVRCKANSHT
QDEQVNKQLADKERVAAALENDSLRAVLDKMLETCA*
Coding >OphauB2|1537
ATGGCTGCCCTCGACAACGCCAACCCCACCATCCTCAGCGCATCCCAGCTGCCCACCCGCCACTGCAAGGCTTCT
CCCCGCTGCGGACCCGACACCATCTACAACGACGTCGTTTTTGGTGACAATGTGCAAGACGACTCCACGTATGCG
CCCGAGCCCATAGACGAGCAGGAAATCTACGACCTCATCTCTTCCATCTCAGACCCCGAACACCCCGTCTCTCTT
GGCCAGCTCTCTGTTGTCAACCTCGACGACATTCATCTCGACCCCCCTCCTGCCCAGCACTCGGCCAACCCCAAC
GCCATTATCCAGGTCGTCGTGGACATTACCCCAACCATTACCCACTGCAGCCTTGCCACCGTTATTGGTCTCGGC
GTCCGCGCCCGTCTGGAGCAATGCCTCCCGCCAAACTACCGCGTCGACGTGCGCTGCAAGGCAAACTCGCACACC
CAAGACGAGCAAGTCAATAAACAGCTCGCCGATAAGGAACGCGTCGCCGCCGCCCTTGAAAACGACTCTCTCCGC
GCCGTCTTGGACAAGATGCTCGAGACATGTGCCTGA
Transcript >OphauB2|1537
ATGGCTGCCCTCGACAACGCCAACCCCACCATCCTCAGCGCATCCCAGCTGCCCACCCGCCACTGCAAGGCTTCT
CCCCGCTGCGGACCCGACACCATCTACAACGACGTCGTTTTTGGTGACAATGTGCAAGACGACTCCACGTATGCG
CCCGAGCCCATAGACGAGCAGGAAATCTACGACCTCATCTCTTCCATCTCAGACCCCGAACACCCCGTCTCTCTT
GGCCAGCTCTCTGTTGTCAACCTCGACGACATTCATCTCGACCCCCCTCCTGCCCAGCACTCGGCCAACCCCAAC
GCCATTATCCAGGTCGTCGTGGACATTACCCCAACCATTACCCACTGCAGCCTTGCCACCGTTATTGGTCTCGGC
GTCCGCGCCCGTCTGGAGCAATGCCTCCCGCCAAACTACCGCGTCGACGTGCGCTGCAAGGCAAACTCGCACACC
CAAGACGAGCAAGTCAATAAACAGCTCGCCGATAAGGAACGCGTCGCCGCCGCCCTTGAAAACGACTCTCTCCGC
GCCGTCTTGGACAAGATGCTCGAGACATGTGCCTGA
Gene >OphauB2|1537
ATGGCTGCCCTCGACAACGCCAACCCCACCATCCTCAGCGCATCCCAGCTGCCCACCCGCCACTGCAAGGCTTCT
CCCCGCTGCGGACCCGACACCATCTACAACGACGTCGTTTTTGGTGACAATGTGCAAGACGACTCCACGTATGCG
CCCGAGCCCATAGACGAGCAGGAAATCTACGGTTTGAGCCCCCCCCCCTCCTTGTGCAGTCGGCATGTGCCATGA
AGCAACTAATTGTCTTGCTGTCCTCTAGACCTCATCTCTTCCATCTCAGACCCCGAACACCCCGTCTCTCTTGGC
CAGCTCTCTGTTGTCAACCTCGACGACATTCATCTCGACCCCCCTCCTGCCCAGCACTCGGCCAACCCCAACGCC
ATTATCCAGGTCGTCGTGGACATTACCCCAACCATTACCCACTGCAGCCTTGCCACCGTTATTGGTCTCGGCGTC
CGCGCCCGTCTGGAGCAATGCCTCCCGCCAAACTACCGCGTCGACGTGCGCTGCAAGGCAAACTCGCACACCCAA
GACGAGCAAGTCAATAAACAGCTCGCCGATAAGGAACGCGTCGCCGCCGCCCTTGAAAACGACTCTCTCCGCGCC
GTCTTGGACAAGATGCTCGAGACATGTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail