Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1534
Gene name
LocationContig_14:265826..268766
Strand+
Gene length (bp)2940
Transcript length (bp)2940
Coding sequence length (bp)2940
Protein length (aa) 980

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05794 Tcp11 T-complex protein 11 3.6E-84 560 964

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K1H7|T11L2_MOUSE T-complex protein 11-like protein 2 OS=Mus musculus GN=Tcp11l2 PE=1 SV=1 561 731 1.0E-10
sp|Q568Z0|T11L2_RAT T-complex protein 11-like protein 2 OS=Rattus norvegicus GN=Tcp11l2 PE=1 SV=1 559 731 1.0E-09
sp|A7Z033|T11L2_BOVIN T-complex protein 11-like protein 2 OS=Bos taurus GN=TCP11L2 PE=2 SV=1 556 731 2.0E-09
sp|Q9NUJ3|T11L1_HUMAN T-complex protein 11-like protein 1 OS=Homo sapiens GN=TCP11L1 PE=1 SV=1 556 968 3.0E-09
sp|Q8N4U5|T11L2_HUMAN T-complex protein 11-like protein 2 OS=Homo sapiens GN=TCP11L2 PE=2 SV=1 556 731 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K1H7|T11L2_MOUSE T-complex protein 11-like protein 2 OS=Mus musculus GN=Tcp11l2 PE=1 SV=1 561 731 1.0E-10
sp|Q568Z0|T11L2_RAT T-complex protein 11-like protein 2 OS=Rattus norvegicus GN=Tcp11l2 PE=1 SV=1 559 731 1.0E-09
sp|A7Z033|T11L2_BOVIN T-complex protein 11-like protein 2 OS=Bos taurus GN=TCP11L2 PE=2 SV=1 556 731 2.0E-09
sp|Q9NUJ3|T11L1_HUMAN T-complex protein 11-like protein 1 OS=Homo sapiens GN=TCP11L1 PE=1 SV=1 556 968 3.0E-09
sp|Q8N4U5|T11L2_HUMAN T-complex protein 11-like protein 2 OS=Homo sapiens GN=TCP11L2 PE=2 SV=1 556 731 3.0E-09
sp|Q8BTG3|T11L1_MOUSE T-complex protein 11-like protein 1 OS=Mus musculus GN=Tcp11l1 PE=1 SV=1 610 731 5.0E-08
sp|B4DZS4|T11X1_HUMAN T-complex protein 11 X-linked protein 1 OS=Homo sapiens GN=TCP11X1 PE=2 SV=1 511 731 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1534
MHLPSPGPDAKMQQGSCSASDEAMDLDLDLAMPPADDDALEQNDRIYTPPPRIAARFYRPSQTRRRGSAASSRRN
SMSSAHSRCSSLQHSASGEGEQSKYVAQHLRRASFLEDRRARLADRAAHAEKVRLRAAMAKAAPRGQSASEERAL
AAQQARQRNLAEIVASCAEEVRKAKQVAEVTKEKREQEIAKMKAKMEDRMAEAERRREELRNKTGSMRCRGHSIA
ARKAREASPRAKDDEAPKISRHVAAARIQDWWRGCRRKGLIDDFNALGLSVDGIRETSFDTVVELLGQEKVLVTT
GGLLRICGLHEGEAGSVGDMAAVRTVLSAFLILGHPNQVLSNKNEGDEDDVAERSGVAAHVLPSADLENPQLQDL
VGKAKDLLIVFEKILARLTWWNRYTMPPALKKTLPETYAVFYNAFIAWKSRDCNALVDVMVMQFVELDAIFQTVK
DSSDDGAAALYRQSIEDSQLMLIVRIKKLAGQEKGRRLIFKAVSEARRGRNAKKRTDDTKPRVADNETGDGSAEM
QTPTPPSTPMGTQEAKGVGIKSGLNGLLPDNRIVVHELAINKEYQIPWEEYVEQQAALSQPLYGQIRRAVGEQDG
EACFGFFMLMAGKIRDKLQRLLKPGNSMYKLIGEMLDAELAQRQFALGNFSYQRFFGAMGSLLPKLCAPFRDEQV
KELVQRGLADGDVIERVEALNGFIDVMVCDYINYLLRMAAPQLIESSAQYEAKRFEADMGGSRLEAAEAAWRSAA
SKVVGEVQPTASRIYAQMLVDVFTQLGPIEAEAVPEMLRLDVARMNAVSTTMRRIVMAGAVLVQCKNLLKRDVRS
PWKTEAARVMAVLEAKSAAPHGSLDGVMAALEAGRSMPAVTRSHLRALVAKVLAAGRDMAEPPREPVLRLLLTRL
RGNLLARLTPTCASDRVRATTLAGEKLAALGLSEFAETVRHLADLLDKVGAVDRAAHGPWWDAVAARVELQTDAQ
SALK*
Coding >OphauB2|1534
ATGCACTTGCCGTCGCCCGGCCCTGATGCCAAGATGCAACAAGGCAGCTGCTCTGCGTCGGACGAGGCTATGGAT
CTCGACCTCGACCTTGCCATGCCGCCCGCCGACGACGACGCCCTCGAGCAAAACGACCGAATCTATACGCCGCCG
CCGCGGATTGCTGCCCGCTTCTACCGTCCGTCACAGACGCGACGCAGAGGCTCTGCGGCGTCGTCGCGCCGCAAC
TCCATGTCGTCGGCCCATTCGCGATGCTCTTCACTGCAGCACTCGGCCTCTGGCGAGGGCGAGCAGAGTAAATAT
GTCGCACAGCACCTGCGCCGCGCTTCCTTTCTCGAGGACCGTAGAGCCCGCCTTGCCGACAGAGCGGCCCATGCC
GAAAAGGTGCGTCTACGGGCTGCAATGGCCAAGGCGGCTCCACGCGGACAGTCGGCCTCGGAGGAGCGGGCTCTG
GCGGCGCAGCAGGCACGGCAGCGCAACCTGGCTGAGATTGTTGCCAGCTGTGCAGAAGAGGTGCGAAAGGCCAAG
CAAGTGGCGGAAGTGACAAAGGAGAAGCGCGAGCAAGAAATCGCCAAGATGAAGGCCAAGATGGAAGATCGCATG
GCTGAGGCGGAGAGGCGGCGCGAGGAGCTGCGCAACAAGACAGGTTCCATGCGCTGCCGCGGCCACAGCATTGCG
GCTCGAAAGGCCAGAGAAGCGTCGCCTCGGGCCAAGGACGACGAGGCGCCCAAAATATCGCGGCACGTGGCTGCT
GCTCGTATCCAGGACTGGTGGCGTGGATGCCGCAGGAAGGGGCTCATTGACGACTTCAACGCCCTGGGGCTCTCG
GTGGACGGCATCCGAGAGACGTCGTTTGACACGGTGGTGGAGCTCCTGGGCCAGGAAAAAGTGCTTGTGACTACT
GGTGGACTGCTGCGCATATGCGGGCTTCACGAGGGTGAAGCGGGCTCAGTGGGCGACATGGCGGCTGTTCGCACC
GTCTTGAGCGCCTTTCTCATTCTCGGGCACCCAAATCAGGTGCTGAGCAACAAGAATGAAGGCGACGAGGACGAC
GTGGCAGAGAGAAGTGGTGTTGCCGCACACGTGCTACCGTCGGCAGACTTGGAGAACCCGCAGCTCCAAGACCTG
GTTGGCAAGGCCAAGGACCTGCTCATTGTCTTTGAGAAGATTTTGGCGCGACTGACATGGTGGAACCGCTACACG
ATGCCGCCGGCGCTCAAGAAGACGCTGCCCGAGACATATGCCGTCTTTTACAATGCCTTTATTGCGTGGAAGTCT
CGGGACTGCAATGCGCTCGTCGACGTCATGGTGATGCAGTTTGTGGAGCTGGATGCCATTTTCCAGACAGTCAAG
GATAGCAGCGACGATGGGGCGGCAGCGCTGTATCGGCAGAGCATCGAGGACAGCCAGCTGATGCTCATTGTGCGG
ATCAAGAAGCTGGCGGGCCAGGAAAAGGGGCGGAGGCTCATTTTCAAGGCGGTGAGCGAGGCGAGGCGAGGACGC
AATGCAAAGAAGCGGACCGACGACACCAAGCCTCGGGTGGCGGACAATGAGACGGGGGATGGATCGGCTGAGATG
CAAACGCCGACGCCCCCATCGACGCCCATGGGCACGCAAGAGGCCAAGGGCGTGGGCATCAAGAGTGGGCTCAAC
GGGCTGCTGCCCGACAACCGCATCGTGGTGCACGAGCTGGCCATCAACAAGGAGTACCAGATCCCGTGGGAGGAG
TATGTGGAGCAGCAGGCAGCTCTGTCGCAGCCTCTGTACGGGCAGATTCGCAGGGCGGTGGGTGAGCAAGATGGC
GAGGCGTGTTTCGGCTTCTTCATGCTCATGGCGGGCAAGATTCGCGACAAGCTGCAGCGACTGCTGAAGCCAGGC
AACTCCATGTACAAGCTGATTGGCGAGATGCTGGACGCGGAGCTGGCGCAGCGGCAGTTTGCGCTGGGCAACTTT
TCCTACCAGCGCTTCTTTGGGGCCATGGGGTCTCTGCTGCCCAAGCTGTGCGCGCCCTTCCGCGACGAGCAAGTC
AAGGAGCTGGTGCAGAGGGGGCTGGCCGACGGCGACGTGATTGAGCGGGTGGAGGCGCTCAACGGCTTCATTGAC
GTCATGGTGTGCGACTACATCAACTACCTGCTGCGCATGGCGGCGCCGCAGCTGATTGAGTCGTCGGCGCAGTAC
GAGGCGAAGCGGTTCGAGGCGGACATGGGCGGGTCGCGGCTCGAGGCGGCCGAGGCAGCATGGCGGAGCGCGGCC
AGCAAGGTGGTGGGCGAGGTGCAGCCGACGGCGTCGCGCATCTACGCGCAGATGCTGGTGGATGTCTTTACGCAG
CTGGGGCCCATCGAGGCGGAGGCGGTGCCCGAGATGCTGCGGCTCGACGTGGCGCGCATGAATGCCGTGTCGACG
ACGATGCGGCGCATTGTCATGGCGGGCGCGGTGCTTGTGCAGTGCAAGAACCTGCTCAAGCGCGACGTGCGGTCG
CCGTGGAAGACGGAGGCGGCGCGCGTCATGGCGGTGCTCGAGGCCAAGAGTGCGGCGCCCCATGGCAGTCTGGAC
GGCGTCATGGCAGCTCTCGAGGCTGGCCGCTCCATGCCCGCCGTGACACGCAGCCATCTGCGCGCCCTCGTCGCC
AAGGTGCTTGCTGCCGGCCGCGACATGGCAGAGCCGCCGCGCGAGCCTGTTCTCCGTCTGCTGCTGACGCGCCTC
CGCGGCAATTTGCTGGCGCGCCTGACGCCCACATGCGCCAGCGACCGCGTCAGGGCCACCACGCTGGCTGGCGAG
AAGCTGGCCGCCTTGGGGCTGTCCGAGTTTGCCGAAACGGTGCGTCACTTGGCCGACTTGCTGGACAAGGTGGGC
GCCGTCGACCGAGCTGCCCACGGGCCCTGGTGGGATGCTGTGGCTGCGCGCGTCGAGCTGCAAACCGACGCCCAG
TCTGCCTTGAAGTAA
Transcript >OphauB2|1534
ATGCACTTGCCGTCGCCCGGCCCTGATGCCAAGATGCAACAAGGCAGCTGCTCTGCGTCGGACGAGGCTATGGAT
CTCGACCTCGACCTTGCCATGCCGCCCGCCGACGACGACGCCCTCGAGCAAAACGACCGAATCTATACGCCGCCG
CCGCGGATTGCTGCCCGCTTCTACCGTCCGTCACAGACGCGACGCAGAGGCTCTGCGGCGTCGTCGCGCCGCAAC
TCCATGTCGTCGGCCCATTCGCGATGCTCTTCACTGCAGCACTCGGCCTCTGGCGAGGGCGAGCAGAGTAAATAT
GTCGCACAGCACCTGCGCCGCGCTTCCTTTCTCGAGGACCGTAGAGCCCGCCTTGCCGACAGAGCGGCCCATGCC
GAAAAGGTGCGTCTACGGGCTGCAATGGCCAAGGCGGCTCCACGCGGACAGTCGGCCTCGGAGGAGCGGGCTCTG
GCGGCGCAGCAGGCACGGCAGCGCAACCTGGCTGAGATTGTTGCCAGCTGTGCAGAAGAGGTGCGAAAGGCCAAG
CAAGTGGCGGAAGTGACAAAGGAGAAGCGCGAGCAAGAAATCGCCAAGATGAAGGCCAAGATGGAAGATCGCATG
GCTGAGGCGGAGAGGCGGCGCGAGGAGCTGCGCAACAAGACAGGTTCCATGCGCTGCCGCGGCCACAGCATTGCG
GCTCGAAAGGCCAGAGAAGCGTCGCCTCGGGCCAAGGACGACGAGGCGCCCAAAATATCGCGGCACGTGGCTGCT
GCTCGTATCCAGGACTGGTGGCGTGGATGCCGCAGGAAGGGGCTCATTGACGACTTCAACGCCCTGGGGCTCTCG
GTGGACGGCATCCGAGAGACGTCGTTTGACACGGTGGTGGAGCTCCTGGGCCAGGAAAAAGTGCTTGTGACTACT
GGTGGACTGCTGCGCATATGCGGGCTTCACGAGGGTGAAGCGGGCTCAGTGGGCGACATGGCGGCTGTTCGCACC
GTCTTGAGCGCCTTTCTCATTCTCGGGCACCCAAATCAGGTGCTGAGCAACAAGAATGAAGGCGACGAGGACGAC
GTGGCAGAGAGAAGTGGTGTTGCCGCACACGTGCTACCGTCGGCAGACTTGGAGAACCCGCAGCTCCAAGACCTG
GTTGGCAAGGCCAAGGACCTGCTCATTGTCTTTGAGAAGATTTTGGCGCGACTGACATGGTGGAACCGCTACACG
ATGCCGCCGGCGCTCAAGAAGACGCTGCCCGAGACATATGCCGTCTTTTACAATGCCTTTATTGCGTGGAAGTCT
CGGGACTGCAATGCGCTCGTCGACGTCATGGTGATGCAGTTTGTGGAGCTGGATGCCATTTTCCAGACAGTCAAG
GATAGCAGCGACGATGGGGCGGCAGCGCTGTATCGGCAGAGCATCGAGGACAGCCAGCTGATGCTCATTGTGCGG
ATCAAGAAGCTGGCGGGCCAGGAAAAGGGGCGGAGGCTCATTTTCAAGGCGGTGAGCGAGGCGAGGCGAGGACGC
AATGCAAAGAAGCGGACCGACGACACCAAGCCTCGGGTGGCGGACAATGAGACGGGGGATGGATCGGCTGAGATG
CAAACGCCGACGCCCCCATCGACGCCCATGGGCACGCAAGAGGCCAAGGGCGTGGGCATCAAGAGTGGGCTCAAC
GGGCTGCTGCCCGACAACCGCATCGTGGTGCACGAGCTGGCCATCAACAAGGAGTACCAGATCCCGTGGGAGGAG
TATGTGGAGCAGCAGGCAGCTCTGTCGCAGCCTCTGTACGGGCAGATTCGCAGGGCGGTGGGTGAGCAAGATGGC
GAGGCGTGTTTCGGCTTCTTCATGCTCATGGCGGGCAAGATTCGCGACAAGCTGCAGCGACTGCTGAAGCCAGGC
AACTCCATGTACAAGCTGATTGGCGAGATGCTGGACGCGGAGCTGGCGCAGCGGCAGTTTGCGCTGGGCAACTTT
TCCTACCAGCGCTTCTTTGGGGCCATGGGGTCTCTGCTGCCCAAGCTGTGCGCGCCCTTCCGCGACGAGCAAGTC
AAGGAGCTGGTGCAGAGGGGGCTGGCCGACGGCGACGTGATTGAGCGGGTGGAGGCGCTCAACGGCTTCATTGAC
GTCATGGTGTGCGACTACATCAACTACCTGCTGCGCATGGCGGCGCCGCAGCTGATTGAGTCGTCGGCGCAGTAC
GAGGCGAAGCGGTTCGAGGCGGACATGGGCGGGTCGCGGCTCGAGGCGGCCGAGGCAGCATGGCGGAGCGCGGCC
AGCAAGGTGGTGGGCGAGGTGCAGCCGACGGCGTCGCGCATCTACGCGCAGATGCTGGTGGATGTCTTTACGCAG
CTGGGGCCCATCGAGGCGGAGGCGGTGCCCGAGATGCTGCGGCTCGACGTGGCGCGCATGAATGCCGTGTCGACG
ACGATGCGGCGCATTGTCATGGCGGGCGCGGTGCTTGTGCAGTGCAAGAACCTGCTCAAGCGCGACGTGCGGTCG
CCGTGGAAGACGGAGGCGGCGCGCGTCATGGCGGTGCTCGAGGCCAAGAGTGCGGCGCCCCATGGCAGTCTGGAC
GGCGTCATGGCAGCTCTCGAGGCTGGCCGCTCCATGCCCGCCGTGACACGCAGCCATCTGCGCGCCCTCGTCGCC
AAGGTGCTTGCTGCCGGCCGCGACATGGCAGAGCCGCCGCGCGAGCCTGTTCTCCGTCTGCTGCTGACGCGCCTC
CGCGGCAATTTGCTGGCGCGCCTGACGCCCACATGCGCCAGCGACCGCGTCAGGGCCACCACGCTGGCTGGCGAG
AAGCTGGCCGCCTTGGGGCTGTCCGAGTTTGCCGAAACGGTGCGTCACTTGGCCGACTTGCTGGACAAGGTGGGC
GCCGTCGACCGAGCTGCCCACGGGCCCTGGTGGGATGCTGTGGCTGCGCGCGTCGAGCTGCAAACCGACGCCCAG
TCTGCCTTGAAGTAA
Gene >OphauB2|1534
ATGCACTTGCCGTCGCCCGGCCCTGATGCCAAGATGCAACAAGGCAGCTGCTCTGCGTCGGACGAGGCTATGGAT
CTCGACCTCGACCTTGCCATGCCGCCCGCCGACGACGACGCCCTCGAGCAAAACGACCGAATCTATACGCCGCCG
CCGCGGATTGCTGCCCGCTTCTACCGTCCGTCACAGACGCGACGCAGAGGCTCTGCGGCGTCGTCGCGCCGCAAC
TCCATGTCGTCGGCCCATTCGCGATGCTCTTCACTGCAGCACTCGGCCTCTGGCGAGGGCGAGCAGAGTAAATAT
GTCGCACAGCACCTGCGCCGCGCTTCCTTTCTCGAGGACCGTAGAGCCCGCCTTGCCGACAGAGCGGCCCATGCC
GAAAAGGTGCGTCTACGGGCTGCAATGGCCAAGGCGGCTCCACGCGGACAGTCGGCCTCGGAGGAGCGGGCTCTG
GCGGCGCAGCAGGCACGGCAGCGCAACCTGGCTGAGATTGTTGCCAGCTGTGCAGAAGAGGTGCGAAAGGCCAAG
CAAGTGGCGGAAGTGACAAAGGAGAAGCGCGAGCAAGAAATCGCCAAGATGAAGGCCAAGATGGAAGATCGCATG
GCTGAGGCGGAGAGGCGGCGCGAGGAGCTGCGCAACAAGACAGGTTCCATGCGCTGCCGCGGCCACAGCATTGCG
GCTCGAAAGGCCAGAGAAGCGTCGCCTCGGGCCAAGGACGACGAGGCGCCCAAAATATCGCGGCACGTGGCTGCT
GCTCGTATCCAGGACTGGTGGCGTGGATGCCGCAGGAAGGGGCTCATTGACGACTTCAACGCCCTGGGGCTCTCG
GTGGACGGCATCCGAGAGACGTCGTTTGACACGGTGGTGGAGCTCCTGGGCCAGGAAAAAGTGCTTGTGACTACT
GGTGGACTGCTGCGCATATGCGGGCTTCACGAGGGTGAAGCGGGCTCAGTGGGCGACATGGCGGCTGTTCGCACC
GTCTTGAGCGCCTTTCTCATTCTCGGGCACCCAAATCAGGTGCTGAGCAACAAGAATGAAGGCGACGAGGACGAC
GTGGCAGAGAGAAGTGGTGTTGCCGCACACGTGCTACCGTCGGCAGACTTGGAGAACCCGCAGCTCCAAGACCTG
GTTGGCAAGGCCAAGGACCTGCTCATTGTCTTTGAGAAGATTTTGGCGCGACTGACATGGTGGAACCGCTACACG
ATGCCGCCGGCGCTCAAGAAGACGCTGCCCGAGACATATGCCGTCTTTTACAATGCCTTTATTGCGTGGAAGTCT
CGGGACTGCAATGCGCTCGTCGACGTCATGGTGATGCAGTTTGTGGAGCTGGATGCCATTTTCCAGACAGTCAAG
GATAGCAGCGACGATGGGGCGGCAGCGCTGTATCGGCAGAGCATCGAGGACAGCCAGCTGATGCTCATTGTGCGG
ATCAAGAAGCTGGCGGGCCAGGAAAAGGGGCGGAGGCTCATTTTCAAGGCGGTGAGCGAGGCGAGGCGAGGACGC
AATGCAAAGAAGCGGACCGACGACACCAAGCCTCGGGTGGCGGACAATGAGACGGGGGATGGATCGGCTGAGATG
CAAACGCCGACGCCCCCATCGACGCCCATGGGCACGCAAGAGGCCAAGGGCGTGGGCATCAAGAGTGGGCTCAAC
GGGCTGCTGCCCGACAACCGCATCGTGGTGCACGAGCTGGCCATCAACAAGGAGTACCAGATCCCGTGGGAGGAG
TATGTGGAGCAGCAGGCAGCTCTGTCGCAGCCTCTGTACGGGCAGATTCGCAGGGCGGTGGGTGAGCAAGATGGC
GAGGCGTGTTTCGGCTTCTTCATGCTCATGGCGGGCAAGATTCGCGACAAGCTGCAGCGACTGCTGAAGCCAGGC
AACTCCATGTACAAGCTGATTGGCGAGATGCTGGACGCGGAGCTGGCGCAGCGGCAGTTTGCGCTGGGCAACTTT
TCCTACCAGCGCTTCTTTGGGGCCATGGGGTCTCTGCTGCCCAAGCTGTGCGCGCCCTTCCGCGACGAGCAAGTC
AAGGAGCTGGTGCAGAGGGGGCTGGCCGACGGCGACGTGATTGAGCGGGTGGAGGCGCTCAACGGCTTCATTGAC
GTCATGGTGTGCGACTACATCAACTACCTGCTGCGCATGGCGGCGCCGCAGCTGATTGAGTCGTCGGCGCAGTAC
GAGGCGAAGCGGTTCGAGGCGGACATGGGCGGGTCGCGGCTCGAGGCGGCCGAGGCAGCATGGCGGAGCGCGGCC
AGCAAGGTGGTGGGCGAGGTGCAGCCGACGGCGTCGCGCATCTACGCGCAGATGCTGGTGGATGTCTTTACGCAG
CTGGGGCCCATCGAGGCGGAGGCGGTGCCCGAGATGCTGCGGCTCGACGTGGCGCGCATGAATGCCGTGTCGACG
ACGATGCGGCGCATTGTCATGGCGGGCGCGGTGCTTGTGCAGTGCAAGAACCTGCTCAAGCGCGACGTGCGGTCG
CCGTGGAAGACGGAGGCGGCGCGCGTCATGGCGGTGCTCGAGGCCAAGAGTGCGGCGCCCCATGGCAGTCTGGAC
GGCGTCATGGCAGCTCTCGAGGCTGGCCGCTCCATGCCCGCCGTGACACGCAGCCATCTGCGCGCCCTCGTCGCC
AAGGTGCTTGCTGCCGGCCGCGACATGGCAGAGCCGCCGCGCGAGCCTGTTCTCCGTCTGCTGCTGACGCGCCTC
CGCGGCAATTTGCTGGCGCGCCTGACGCCCACATGCGCCAGCGACCGCGTCAGGGCCACCACGCTGGCTGGCGAG
AAGCTGGCCGCCTTGGGGCTGTCCGAGTTTGCCGAAACGGTGCGTCACTTGGCCGACTTGCTGGACAAGGTGGGC
GCCGTCGACCGAGCTGCCCACGGGCCCTGGTGGGATGCTGTGGCTGCGCGCGTCGAGCTGCAAACCGACGCCCAG
TCTGCCTTGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail