Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1533
Gene name
LocationContig_14:260943..263610
Strand+
Gene length (bp)2667
Transcript length (bp)2616
Coding sequence length (bp)2616
Protein length (aa) 872

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00102 Y_phosphatase Protein-tyrosine phosphatase 4.7E-52 487 742
PF00102 Y_phosphatase Protein-tyrosine phosphatase 7.6E-05 809 841
PF00581 Rhodanese Rhodanese-like domain 2.0E-09 232 349

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27574|PYP1_SCHPO Tyrosine-protein phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyp1 PE=1 SV=1 246 768 5.0E-42
sp|P20417|PTN1_RAT Tyrosine-protein phosphatase non-receptor type 1 OS=Rattus norvegicus GN=Ptpn1 PE=1 SV=1 456 742 2.0E-35
sp|O13016|PTN1_CHICK Tyrosine-protein phosphatase non-receptor type 1 OS=Gallus gallus GN=PTPN1 PE=1 SV=1 462 742 5.0E-35
sp|P18031|PTN1_HUMAN Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens GN=PTPN1 PE=1 SV=1 456 742 1.0E-34
sp|P35821|PTN1_MOUSE Tyrosine-protein phosphatase non-receptor type 1 OS=Mus musculus GN=Ptpn1 PE=1 SV=2 464 742 3.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27574|PYP1_SCHPO Tyrosine-protein phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyp1 PE=1 SV=1 246 768 5.0E-42
sp|P20417|PTN1_RAT Tyrosine-protein phosphatase non-receptor type 1 OS=Rattus norvegicus GN=Ptpn1 PE=1 SV=1 456 742 2.0E-35
sp|O13016|PTN1_CHICK Tyrosine-protein phosphatase non-receptor type 1 OS=Gallus gallus GN=PTPN1 PE=1 SV=1 462 742 5.0E-35
sp|P18031|PTN1_HUMAN Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens GN=PTPN1 PE=1 SV=1 456 742 1.0E-34
sp|P35821|PTN1_MOUSE Tyrosine-protein phosphatase non-receptor type 1 OS=Mus musculus GN=Ptpn1 PE=1 SV=2 464 742 3.0E-33
sp|Q99952|PTN18_HUMAN Tyrosine-protein phosphatase non-receptor type 18 OS=Homo sapiens GN=PTPN18 PE=1 SV=2 487 748 3.0E-32
sp|P43378|PTN9_HUMAN Tyrosine-protein phosphatase non-receptor type 9 OS=Homo sapiens GN=PTPN9 PE=1 SV=1 487 743 6.0E-32
sp|O35239|PTN9_MOUSE Tyrosine-protein phosphatase non-receptor type 9 OS=Mus musculus GN=Ptpn9 PE=1 SV=2 388 743 6.0E-32
sp|Q641Z2|PTN9_RAT Tyrosine-protein phosphatase non-receptor type 9 OS=Rattus norvegicus GN=Ptpn9 PE=2 SV=1 388 743 2.0E-31
sp|P40048|PTP3_YEAST Tyrosine-protein phosphatase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTP3 PE=1 SV=2 480 863 5.0E-31
sp|P04157|PTPRC_RAT Receptor-type tyrosine-protein phosphatase C OS=Rattus norvegicus GN=Ptprc PE=1 SV=2 487 813 5.0E-31
sp|P06800|PTPRC_MOUSE Receptor-type tyrosine-protein phosphatase C OS=Mus musculus GN=Ptprc PE=1 SV=3 487 741 7.0E-31
sp|P35233|PTN2_RAT Tyrosine-protein phosphatase non-receptor type 2 OS=Rattus norvegicus GN=Ptpn2 PE=1 SV=2 453 742 2.0E-30
sp|P17706|PTN2_HUMAN Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens GN=PTPN2 PE=1 SV=2 453 763 2.0E-30
sp|P08575|PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens GN=PTPRC PE=1 SV=2 487 741 4.0E-30
sp|Q9IBD8|PTPRC_CYPCA Receptor-type tyrosine-protein phosphatase C OS=Cyprinus carpio GN=ptprc PE=2 SV=1 483 741 4.0E-30
sp|P81718|PTN6_RAT Tyrosine-protein phosphatase non-receptor type 6 OS=Rattus norvegicus GN=Ptpn6 PE=1 SV=1 483 738 5.0E-30
sp|P29351|PTN6_MOUSE Tyrosine-protein phosphatase non-receptor type 6 OS=Mus musculus GN=Ptpn6 PE=1 SV=2 483 740 8.0E-30
sp|Q06180|PTN2_MOUSE Tyrosine-protein phosphatase non-receptor type 2 OS=Mus musculus GN=Ptpn2 PE=1 SV=2 453 742 1.0E-29
sp|Q61152|PTN18_MOUSE Tyrosine-protein phosphatase non-receptor type 18 OS=Mus musculus GN=Ptpn18 PE=1 SV=1 487 740 1.0E-29
sp|Q9W0G1|PTP61_DROME Tyrosine-protein phosphatase non-receptor type 61F OS=Drosophila melanogaster GN=Ptp61F PE=1 SV=1 488 748 1.0E-29
sp|P29350|PTN6_HUMAN Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens GN=PTPN6 PE=1 SV=1 483 738 1.0E-29
sp|P28191|PTP1_CAEEL Tyrosine-protein phosphatase 1 OS=Caenorhabditis elegans GN=ptp-1 PE=2 SV=3 487 741 1.0E-29
sp|Q9W6V5|PTPRJ_CHICK Receptor-type tyrosine-protein phosphatase eta OS=Gallus gallus GN=PTPRJ PE=2 SV=2 476 741 5.0E-29
sp|P23470|PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens GN=PTPRG PE=1 SV=4 483 862 6.0E-29
sp|Q64455|PTPRJ_MOUSE Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus GN=Ptprj PE=1 SV=2 476 737 6.0E-29
sp|Q12913|PTPRJ_HUMAN Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens GN=PTPRJ PE=1 SV=3 476 737 6.0E-29
sp|P70289|PTPRV_MOUSE Receptor-type tyrosine-protein phosphatase V OS=Mus musculus GN=Ptprv PE=2 SV=1 487 745 9.0E-29
sp|P49446|PTPRE_MOUSE Receptor-type tyrosine-protein phosphatase epsilon OS=Mus musculus GN=Ptpre PE=1 SV=3 454 740 1.0E-28
sp|B2GV87|PTPRE_RAT Receptor-type tyrosine-protein phosphatase epsilon OS=Rattus norvegicus GN=Ptpre PE=2 SV=1 454 740 1.0E-28
sp|Q64612|PTPRV_RAT Receptor-type tyrosine-protein phosphatase V OS=Rattus norvegicus GN=Ptprv PE=1 SV=1 487 730 2.0E-28
sp|Q64512|PTN13_MOUSE Tyrosine-protein phosphatase non-receptor type 13 OS=Mus musculus GN=Ptpn13 PE=1 SV=2 487 791 2.0E-28
sp|P35831|PTN12_MOUSE Tyrosine-protein phosphatase non-receptor type 12 OS=Mus musculus GN=Ptpn12 PE=1 SV=3 487 741 3.0E-28
sp|Q05209|PTN12_HUMAN Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens GN=PTPN12 PE=1 SV=3 487 741 3.0E-28
sp|P23469|PTPRE_HUMAN Receptor-type tyrosine-protein phosphatase epsilon OS=Homo sapiens GN=PTPRE PE=1 SV=1 454 740 3.0E-28
sp|P18433|PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens GN=PTPRA PE=1 SV=2 487 740 4.0E-28
sp|P23467|PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens GN=PTPRB PE=1 SV=3 449 740 4.0E-28
sp|A1L1L3|PTN20_RAT Tyrosine-protein phosphatase non-receptor type 20 OS=Rattus norvegicus GN=Ptpn20 PE=1 SV=1 487 742 5.0E-28
sp|P29461|PTP2_YEAST Tyrosine-protein phosphatase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTP2 PE=1 SV=1 481 852 6.0E-28
sp|Q05909|PTPRG_MOUSE Receptor-type tyrosine-protein phosphatase gamma OS=Mus musculus GN=Ptprg PE=1 SV=1 487 741 6.0E-28
sp|Q12923|PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens GN=PTPN13 PE=1 SV=2 487 845 8.0E-28
sp|P35992|PTP10_DROME Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster GN=Ptp10D PE=1 SV=4 487 741 9.0E-28
sp|O55082|PTN20_MOUSE Tyrosine-protein phosphatase non-receptor type 20 OS=Mus musculus GN=Ptpn20 PE=1 SV=1 487 742 1.0E-27
sp|Q03348|PTPRA_RAT Receptor-type tyrosine-protein phosphatase alpha OS=Rattus norvegicus GN=Ptpra PE=1 SV=1 487 740 1.0E-27
sp|P34137|PTP1_DICDI Tyrosine-protein phosphatase 1 OS=Dictyostelium discoideum GN=ptpA1-1 PE=2 SV=2 487 743 2.0E-27
sp|P32587|PYP3_SCHPO Tyrosine-protein phosphatase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyp3 PE=3 SV=1 487 737 2.0E-27
sp|P23471|PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens GN=PTPRZ1 PE=1 SV=4 487 744 2.0E-27
sp|B2RU80|PTPRB_MOUSE Receptor-type tyrosine-protein phosphatase beta OS=Mus musculus GN=Ptprb PE=1 SV=1 449 740 3.0E-27
sp|P26045|PTN3_HUMAN Tyrosine-protein phosphatase non-receptor type 3 OS=Homo sapiens GN=PTPN3 PE=1 SV=2 487 742 3.0E-27
sp|Q4JDL3|PTN20_HUMAN Tyrosine-protein phosphatase non-receptor type 20 OS=Homo sapiens GN=PTPN20 PE=1 SV=1 487 767 4.0E-27
sp|P16620|PTP69_DROME Tyrosine-protein phosphatase 69D OS=Drosophila melanogaster GN=Ptp69D PE=1 SV=2 483 741 4.0E-27
sp|Q62136|PTN21_MOUSE Tyrosine-protein phosphatase non-receptor type 21 OS=Mus musculus GN=Ptpn21 PE=1 SV=1 381 741 4.0E-27
sp|Q16827|PTPRO_HUMAN Receptor-type tyrosine-protein phosphatase O OS=Homo sapiens GN=PTPRO PE=1 SV=2 486 796 5.0E-27
sp|Q98936|PTPRG_CHICK Receptor-type tyrosine-protein phosphatase gamma OS=Gallus gallus GN=PTPRG PE=2 SV=1 487 741 5.0E-27
sp|Q15262|PTPRK_HUMAN Receptor-type tyrosine-protein phosphatase kappa OS=Homo sapiens GN=PTPRK PE=1 SV=2 487 742 6.0E-27
sp|B0V2N1|PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus GN=Ptprs PE=1 SV=1 445 741 7.0E-27
sp|O14522|PTPRT_HUMAN Receptor-type tyrosine-protein phosphatase T OS=Homo sapiens GN=PTPRT PE=1 SV=6 487 739 8.0E-27
sp|Q99M80|PTPRT_MOUSE Receptor-type tyrosine-protein phosphatase T OS=Mus musculus GN=Ptprt PE=1 SV=2 487 739 9.0E-27
sp|Q62656|PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus GN=Ptprz1 PE=1 SV=1 487 744 1.0E-26
sp|B9EKR1|PRPTZ_MOUSE Receptor-type tyrosine-protein phosphatase zeta OS=Mus musculus GN=Ptprz1 PE=1 SV=1 487 744 2.0E-26
sp|Q64605|PTPRS_RAT Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus GN=Ptprs PE=1 SV=2 445 763 2.0E-26
sp|A7MBJ4|PTPRF_BOVIN Receptor-type tyrosine-protein phosphatase F OS=Bos taurus GN=PTPRF PE=2 SV=1 445 741 2.0E-26
sp|A2ALK8|PTN3_MOUSE Tyrosine-protein phosphatase non-receptor type 3 OS=Mus musculus GN=Ptpn3 PE=1 SV=1 487 742 2.0E-26
sp|A4IFW2|PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio GN=ptprf PE=2 SV=1 445 741 3.0E-26
sp|Q64604|PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus GN=Ptprf PE=2 SV=1 445 741 3.0E-26
sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens GN=PTPRF PE=1 SV=2 445 741 3.0E-26
sp|Q9Y2R2|PTN22_HUMAN Tyrosine-protein phosphatase non-receptor type 22 OS=Homo sapiens GN=PTPN22 PE=1 SV=2 487 741 4.0E-26
sp|Q15678|PTN14_HUMAN Tyrosine-protein phosphatase non-receptor type 14 OS=Homo sapiens GN=PTPN14 PE=1 SV=2 483 737 4.0E-26
sp|Q62728|PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus GN=Ptpn21 PE=2 SV=1 381 741 5.0E-26
sp|P28828|PTPRM_MOUSE Receptor-type tyrosine-protein phosphatase mu OS=Mus musculus GN=Ptprm PE=1 SV=2 483 742 7.0E-26
sp|Q13332|PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens GN=PTPRS PE=1 SV=3 451 741 8.0E-26
sp|P23468|PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens GN=PTPRD PE=1 SV=2 445 741 1.0E-25
sp|Q64487|PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus GN=Ptprd PE=1 SV=3 445 741 1.0E-25
sp|P29352|PTN22_MOUSE Tyrosine-protein phosphatase non-receptor type 22 OS=Mus musculus GN=Ptpn22 PE=1 SV=1 487 741 1.0E-25
sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus GN=Ptprf PE=1 SV=1 445 741 1.0E-25
sp|E9Q612|PTPRO_MOUSE Receptor-type tyrosine-protein phosphatase O OS=Mus musculus GN=Ptpro PE=1 SV=1 486 796 1.0E-25
sp|Q8BUM3|PTN7_MOUSE Tyrosine-protein phosphatase non-receptor type 7 OS=Mus musculus GN=Ptpn7 PE=1 SV=1 487 730 2.0E-25
sp|Q9HD43|PTPRH_HUMAN Receptor-type tyrosine-protein phosphatase H OS=Homo sapiens GN=PTPRH PE=1 SV=3 446 741 2.0E-25
sp|P35822|PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus GN=Ptprk PE=1 SV=1 487 742 3.0E-25
sp|Q9BMN8|LAR_CAEEL Tyrosine-protein phosphatase Lar-like OS=Caenorhabditis elegans GN=ptp-3 PE=1 SV=1 487 741 3.0E-25
sp|P28827|PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens GN=PTPRM PE=1 SV=2 483 742 4.0E-25
sp|P35236|PTN7_HUMAN Tyrosine-protein phosphatase non-receptor type 7 OS=Homo sapiens GN=PTPN7 PE=1 SV=3 487 741 5.0E-25
sp|Q16825|PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens GN=PTPN21 PE=1 SV=2 409 741 6.0E-25
sp|P49445|PTN7_RAT Tyrosine-protein phosphatase non-receptor type 7 OS=Rattus norvegicus GN=Ptpn7 PE=1 SV=1 487 730 6.0E-25
sp|P35832|PTP99_DROME Tyrosine-protein phosphatase 99A OS=Drosophila melanogaster GN=Ptp99A PE=2 SV=2 483 744 8.0E-25
sp|Q62130|PTN14_MOUSE Tyrosine-protein phosphatase non-receptor type 14 OS=Mus musculus GN=Ptpn14 PE=1 SV=2 483 737 9.0E-25
sp|Q9WU22|PTN4_MOUSE Tyrosine-protein phosphatase non-receptor type 4 OS=Mus musculus GN=Ptpn4 PE=1 SV=2 487 741 1.0E-24
sp|P18433|PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens GN=PTPRA PE=1 SV=2 487 741 3.0E-24
sp|Q90687|PTN11_CHICK Tyrosine-protein phosphatase non-receptor type 11 OS=Gallus gallus GN=PTPN11 PE=2 SV=1 483 747 4.0E-24
sp|P16621|LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster GN=Lar PE=1 SV=2 451 745 4.0E-24
sp|P18052|PTPRA_MOUSE Receptor-type tyrosine-protein phosphatase alpha OS=Mus musculus GN=Ptpra PE=1 SV=3 487 741 5.0E-24
sp|Q5I146|PTPH2_MDBVW Tyrosine phosphatase H2 OS=Microplitis demolitor bracovirus (isolate Webb) GN=H2 PE=3 SV=1 488 737 5.0E-24
sp|Q06124|PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens GN=PTPN11 PE=1 SV=2 483 747 5.0E-24
sp|P35235|PTN11_MOUSE Tyrosine-protein phosphatase non-receptor type 11 OS=Mus musculus GN=Ptpn11 PE=1 SV=2 483 747 8.0E-24
sp|Q03348|PTPRA_RAT Receptor-type tyrosine-protein phosphatase alpha OS=Rattus norvegicus GN=Ptpra PE=1 SV=1 487 741 1.0E-23
sp|P41499|PTN11_RAT Tyrosine-protein phosphatase non-receptor type 11 OS=Rattus norvegicus GN=Ptpn11 PE=1 SV=4 483 747 1.0E-23
sp|P54637|PTP3_DICDI Tyrosine-protein phosphatase 3 OS=Dictyostelium discoideum GN=ptpC PE=2 SV=2 487 743 1.0E-23
sp|P18052|PTPRA_MOUSE Receptor-type tyrosine-protein phosphatase alpha OS=Mus musculus GN=Ptpra PE=1 SV=3 474 740 3.0E-23
sp|P80560|PTPR2_MOUSE Receptor-type tyrosine-protein phosphatase N2 OS=Mus musculus GN=Ptprn2 PE=1 SV=2 483 742 3.0E-23
sp|P28192|PTP4_CAEEL Tyrosine-protein phosphatase 4 OS=Caenorhabditis elegans GN=ptp-4 PE=2 SV=3 487 843 3.0E-23
sp|A4IFW2|PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio GN=ptprf PE=2 SV=1 487 741 4.0E-23
sp|Q24708|CSW_DROVI Tyrosine-protein phosphatase corkscrew (Fragment) OS=Drosophila virilis GN=csw PE=3 SV=1 526 742 7.0E-23
sp|Q64487|PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus GN=Ptprd PE=1 SV=3 487 741 9.0E-23
sp|B0V2N1|PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus GN=Ptprs PE=1 SV=1 487 741 1.0E-22
sp|Q64605|PTPRS_RAT Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus GN=Ptprs PE=1 SV=2 487 741 1.0E-22
sp|P29074|PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 OS=Homo sapiens GN=PTPN4 PE=1 SV=1 487 741 1.0E-22
sp|A7MBJ4|PTPRF_BOVIN Receptor-type tyrosine-protein phosphatase F OS=Bos taurus GN=PTPRF PE=2 SV=1 487 741 2.0E-22
sp|Q64604|PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus GN=Ptprf PE=2 SV=1 487 741 2.0E-22
sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens GN=PTPRF PE=1 SV=2 487 741 2.0E-22
sp|Q13332|PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens GN=PTPRS PE=1 SV=3 487 741 2.0E-22
sp|P23468|PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens GN=PTPRD PE=1 SV=2 487 741 2.0E-22
sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus GN=Ptprf PE=1 SV=1 487 741 2.0E-22
sp|H2KZM6|PTPR_CAEEL Receptor-type tyrosine-protein phosphatase OS=Caenorhabditis elegans GN=clr-1 PE=1 SV=1 483 738 2.0E-22
sp|Q16849|PTPRN_HUMAN Receptor-type tyrosine-protein phosphatase-like N OS=Homo sapiens GN=PTPRN PE=1 SV=1 487 742 5.0E-22
sp|Q63475|PTPR2_RAT Receptor-type tyrosine-protein phosphatase N2 OS=Rattus norvegicus GN=Ptprn2 PE=1 SV=1 483 742 6.0E-22
sp|P56722|PTPRN_BOVIN Receptor-type tyrosine-protein phosphatase-like N OS=Bos taurus GN=PTPRN PE=1 SV=1 487 742 1.0E-21
sp|Q63259|PTPRN_RAT Receptor-type tyrosine-protein phosphatase-like N OS=Rattus norvegicus GN=Ptprn PE=1 SV=2 487 742 1.0E-21
sp|P29349|CSW_DROME Tyrosine-protein phosphatase corkscrew OS=Drosophila melanogaster GN=csw PE=1 SV=2 526 742 1.0E-21
sp|Q8ISC9|CSW_DROSI Tyrosine-protein phosphatase corkscrew (Fragment) OS=Drosophila simulans GN=csw PE=3 SV=1 526 742 1.0E-21
sp|Q60673|PTPRN_MOUSE Receptor-type tyrosine-protein phosphatase-like N OS=Mus musculus GN=Ptprn PE=1 SV=2 487 742 2.0E-21
sp|P34138|PTP2_DICDI Tyrosine-protein phosphatase 2 OS=Dictyostelium discoideum GN=ptpB PE=2 SV=1 512 841 3.0E-21
sp|Q92932|PTPR2_HUMAN Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens GN=PTPRN2 PE=1 SV=2 454 768 4.0E-21
sp|Q9UMZ3|PTPRQ_HUMAN Phosphatidylinositol phosphatase PTPRQ OS=Homo sapiens GN=PTPRQ PE=1 SV=2 486 734 6.0E-21
sp|P23469|PTPRE_HUMAN Receptor-type tyrosine-protein phosphatase epsilon OS=Homo sapiens GN=PTPRE PE=1 SV=1 449 758 7.0E-21
sp|O02695|PTPR2_MACNE Receptor-type tyrosine-protein phosphatase N2 OS=Macaca nemestrina GN=PTPRN2 PE=2 SV=1 487 768 7.0E-21
sp|P35234|PTN5_RAT Tyrosine-protein phosphatase non-receptor type 5 OS=Rattus norvegicus GN=Ptpn5 PE=2 SV=2 487 742 1.0E-20
sp|P54830|PTN5_MOUSE Tyrosine-protein phosphatase non-receptor type 5 OS=Mus musculus GN=Ptpn5 PE=1 SV=2 487 742 1.0E-20
sp|O82656|PTP1_ARATH Protein-tyrosine-phosphatase PTP1 OS=Arabidopsis thaliana GN=PTP1 PE=1 SV=1 487 751 2.0E-20
sp|P49446|PTPRE_MOUSE Receptor-type tyrosine-protein phosphatase epsilon OS=Mus musculus GN=Ptpre PE=1 SV=3 449 758 3.0E-20
sp|O88488|PTPRQ_RAT Phosphatidylinositol phosphatase PTPRQ OS=Rattus norvegicus GN=Ptprq PE=1 SV=1 486 762 3.0E-20
sp|B3DK56|PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio GN=ptpru PE=2 SV=1 487 739 6.0E-20
sp|B2GV87|PTPRE_RAT Receptor-type tyrosine-protein phosphatase epsilon OS=Rattus norvegicus GN=Ptpre PE=2 SV=1 449 758 7.0E-20
sp|Q9H3S7|PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens GN=PTPN23 PE=1 SV=1 487 737 9.0E-20
sp|P0C5E4|PTPRQ_MOUSE Phosphatidylinositol phosphatase PTPRQ OS=Mus musculus GN=Ptprq PE=1 SV=1 486 734 2.0E-19
sp|P25044|PTP1_YEAST Tyrosine-protein phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTP1 PE=1 SV=1 448 836 2.0E-19
sp|P16621|LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster GN=Lar PE=1 SV=2 487 741 3.0E-19
sp|Q6PB44|PTN23_MOUSE Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus GN=Ptpn23 PE=1 SV=2 487 737 3.0E-19
sp|O88902|PTN23_RAT Tyrosine-protein phosphatase non-receptor type 23 (Fragment) OS=Rattus norvegicus GN=Ptpn23 PE=1 SV=2 486 737 5.0E-19
sp|P54829|PTN5_HUMAN Tyrosine-protein phosphatase non-receptor type 5 OS=Homo sapiens GN=PTPN5 PE=1 SV=4 487 742 1.0E-18
sp|Q92729|PTPRU_HUMAN Receptor-type tyrosine-protein phosphatase U OS=Homo sapiens GN=PTPRU PE=1 SV=2 496 739 3.0E-18
sp|Q5I141|PTPJ1_MDBVW Tyrosine phosphatase-like protein J1 OS=Microplitis demolitor bracovirus (isolate Webb) GN=J1 PE=3 SV=1 456 737 3.0E-18
sp|Q6YI48|PTPRU_CHICK Receptor-type tyrosine-protein phosphatase U OS=Gallus gallus GN=PTPRU PE=2 SV=1 487 739 5.0E-18
sp|Q15256|PTPRR_HUMAN Receptor-type tyrosine-protein phosphatase R OS=Homo sapiens GN=PTPRR PE=1 SV=2 485 730 5.0E-18
sp|P32586|PYP2_SCHPO Tyrosine-protein phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyp2 PE=1 SV=1 487 583 7.0E-18
sp|Q5I145|PTPH3_MDBVW Tyrosine phosphatase H3 OS=Microplitis demolitor bracovirus (isolate Webb) GN=H3 PE=3 SV=1 487 744 7.0E-18
sp|B1AUH1|PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus GN=Ptpru PE=1 SV=1 512 739 2.0E-17
sp|Q62132|PTPRR_MOUSE Receptor-type tyrosine-protein phosphatase R OS=Mus musculus GN=Ptprr PE=1 SV=1 485 730 2.0E-17
sp|Q9BMN8|LAR_CAEEL Tyrosine-protein phosphatase Lar-like OS=Caenorhabditis elegans GN=ptp-3 PE=1 SV=1 487 741 3.0E-17
sp|O08617|PTPRR_RAT Receptor-type tyrosine-protein phosphatase R OS=Rattus norvegicus GN=Ptprr PE=1 SV=2 485 730 7.0E-17
sp|Q5I143|PTPH4_MDBVW Probable tyrosine phosphatase protein H4 OS=Microplitis demolitor bracovirus (isolate Webb) GN=H5 PE=3 SV=1 527 744 2.0E-16
sp|Q5I128|PTPN1_MDBVW Probable tyrosine phosphatase protein N1 OS=Microplitis demolitor bracovirus (isolate Webb) GN=N3 PE=3 SV=1 487 749 8.0E-16
sp|P08575|PTPRC_HUMAN Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens GN=PTPRC PE=1 SV=2 483 738 2.0E-15
sp|Q99M80|PTPRT_MOUSE Receptor-type tyrosine-protein phosphatase T OS=Mus musculus GN=Ptprt PE=1 SV=2 487 760 1.0E-14
sp|P04157|PTPRC_RAT Receptor-type tyrosine-protein phosphatase C OS=Rattus norvegicus GN=Ptprc PE=1 SV=2 487 738 1.0E-12
sp|P06800|PTPRC_MOUSE Receptor-type tyrosine-protein phosphatase C OS=Mus musculus GN=Ptprc PE=1 SV=3 487 738 1.0E-11
sp|Q5I142|PTPH5_MDBVW Tyrosine phosphatase-like protein H5 OS=Microplitis demolitor bracovirus (isolate Webb) GN=H6 PE=3 SV=1 479 688 8.0E-11
sp|H2KZM6|PTPR_CAEEL Receptor-type tyrosine-protein phosphatase OS=Caenorhabditis elegans GN=clr-1 PE=1 SV=1 433 733 4.0E-10
sp|Q62656|PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus GN=Ptprz1 PE=1 SV=1 487 748 9.0E-10
sp|B9EKR1|PRPTZ_MOUSE Receptor-type tyrosine-protein phosphatase zeta OS=Mus musculus GN=Ptprz1 PE=1 SV=1 487 748 9.0E-10
sp|P23471|PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens GN=PTPRZ1 PE=1 SV=4 457 748 2.0E-09
sp|P16620|PTP69_DROME Tyrosine-protein phosphatase 69D OS=Drosophila melanogaster GN=Ptp69D PE=1 SV=2 483 741 3.0E-09
sp|Q5I127|PTPN2_MDBVW Tyrosine phosphatase-like protein N2 OS=Microplitis demolitor bracovirus (isolate Webb) GN=N4 PE=3 SV=1 532 686 4.0E-09
sp|P23470|PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens GN=PTPRG PE=1 SV=4 483 748 2.0E-08
sp|Q05909|PTPRG_MOUSE Receptor-type tyrosine-protein phosphatase gamma OS=Mus musculus GN=Ptprg PE=1 SV=1 483 748 2.0E-08
sp|Q9IBD8|PTPRC_CYPCA Receptor-type tyrosine-protein phosphatase C OS=Cyprinus carpio GN=ptprc PE=2 SV=1 487 583 3.0E-08
sp|Q98936|PTPRG_CHICK Receptor-type tyrosine-protein phosphatase gamma OS=Gallus gallus GN=PTPRG PE=2 SV=1 483 748 4.0E-08
sp|P32586|PYP2_SCHPO Tyrosine-protein phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyp2 PE=1 SV=1 247 356 1.0E-07
sp|Q9VVW5|DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster GN=Mkp3 PE=1 SV=2 233 372 1.0E-07
sp|P40048|PTP3_YEAST Tyrosine-protein phosphatase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTP3 PE=1 SV=2 227 372 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006470 protein dephosphorylation Yes
GO:0004725 protein tyrosine phosphatase activity Yes
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006793 phosphorus metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0016791 phosphatase activity No
GO:0016311 dephosphorylation No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0004721 phosphoprotein phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1533
MLSPKRHQEARASSPNYFGLAVEATSESRETSGLVRENWNSASSSVKSFAAALPKQIPLEPNADFEAFKRQADIN
RGKSFSLPTAHQLHPPSLATPVRPRPPRWHTHVSDADSDSFFPSTTAFRKDGINGRIDVDQASLHDSAYVSSDSK
RNSEVSTIPMSITGMPRFDSPRLLDLSQCHTTTLSKPDGCDSRLSLMTSKVDPPSPQPADMSRAATLPSKLDSAS
RMMSVGDLKELVDSPDSQHLLLLDIRSSQSHALSHIRGALNLCIPTTLLKRPTFNIQKLQQTFHGGSSSSKFSRW
RDMRWIVVYDAHASDKRDAVTAQNMIRKFTNEGYSGSTAILRGGFTLFEKTYPKLVDEGCDSPTSPSQSNSNSRA
SKGLAPVIGGVNLPQSTNEPDPFFSNIRQNIDLADGVGQLEVAWPLGLDLMQLPHWLRDAASNSDKGKRVSDKFL
RIELDEQSRMRSAYAAFNPNLRQESKFYLSGVEKGCKNRYKDILPFDHARVRLQHKPEGSCDYVNASHLKTSGSN
KRYIASQGPLPATFEDFWTVIWEQDVRVVVMLTAESEGGQLKCHSYWKGRDFGALKLKSLSERKVSLNLDKQRSN
DFKKKTSIATGSENSTPTKTSENQDGPSHAPYVIVRKFALSHAAYPFAPIREITHLHFSSWPDFGTPAQPAHLLA
LVELANLTQQAAFPVETANVMSSMSTWQLQEPEKNAHTRPMLVHCSAGCGRTGTFCTVDTVIDMMKRLQLSKMAV
AHPSKDLQGDVAMTDDHILGPHGAFQAPHAQSFFTHDVAYHDKGTSQIDTNWMHDDTIDLIQRTVEEFREQRLSM
VQTLRQYVLCYETVLEWIYRTSDRKSAADATSRMRAGGFVKARHES*
Coding >OphauB2|1533
ATGCTATCCCCCAAGCGGCACCAGGAGGCTCGGGCCTCAAGTCCAAATTATTTTGGCCTTGCCGTTGAGGCGACT
AGTGAATCTCGCGAAACATCAGGCTTAGTACGAGAGAATTGGAACTCGGCCTCGTCTTCGGTCAAGTCCTTTGCC
GCCGCTCTCCCTAAACAAATTCCACTAGAGCCAAACGCCGATTTCGAAGCCTTCAAAAGGCAAGCAGATATTAAT
AGAGGCAAGTCGTTTTCACTTCCTACAGCTCACCAACTGCACCCGCCGTCGCTCGCTACCCCAGTGCGCCCACGA
CCGCCTCGGTGGCATACTCATGTCAGCGATGCCGACTCGGACTCATTTTTCCCGTCAACAACAGCCTTTCGCAAA
GATGGCATCAATGGGCGAATCGATGTTGACCAGGCTAGCCTACATGATTCGGCTTATGTGTCCTCTGATTCCAAG
CGCAACTCTGAAGTGTCCACAATTCCCATGTCAATTACAGGAATGCCCAGGTTCGATTCTCCGCGGCTTTTGGAC
CTTTCACAGTGCCATACTACTACTCTCTCCAAGCCGGATGGGTGCGACAGCAGGTTATCTCTCATGACGAGCAAG
GTTGACCCTCCCTCTCCTCAACCGGCTGATATGAGCCGTGCGGCCACCCTGCCATCAAAACTTGACTCAGCCTCG
CGTATGATGTCGGTTGGCGACCTTAAAGAACTGGTCGATTCGCCAGACAGCCAGCACCTTCTACTCTTGGATATT
CGCTCTTCACAAAGTCACGCCCTGTCGCATATCCGCGGGGCTCTCAACCTGTGCATCCCCACAACGCTACTGAAG
CGGCCAACATTCAATATCCAAAAGCTCCAGCAGACATTTCATGGCGGATCTAGCTCATCGAAATTCTCTAGATGG
CGCGACATGCGATGGATTGTAGTGTACGATGCTCATGCTTCAGACAAGCGCGATGCCGTAACGGCCCAAAACATG
ATCAGAAAGTTTACCAACGAAGGCTATTCGGGAAGCACCGCCATCCTGCGTGGGGGCTTCACTCTCTTTGAAAAG
ACGTACCCGAAACTTGTCGATGAGGGATGCGACTCACCAACATCGCCAAGCCAGTCCAACTCGAATTCACGAGCC
AGCAAAGGCCTCGCTCCCGTCATTGGCGGAGTGAATCTGCCCCAGTCGACTAATGAGCCAGATCCCTTCTTCTCC
AACATTCGGCAAAACATTGACTTGGCTGATGGCGTCGGTCAACTCGAGGTGGCATGGCCTCTAGGTCTGGATTTG
ATGCAGTTGCCACACTGGCTGCGCGATGCAGCCTCTAATTCGGACAAGGGCAAAAGGGTGTCGGACAAGTTTCTC
CGCATCGAACTCGACGAACAGTCGCGAATGAGAAGTGCATACGCTGCCTTTAATCCCAATCTTCGACAAGAGAGC
AAGTTCTATCTATCAGGCGTTGAGAAGGGCTGCAAGAACCGATACAAAGACATCTTGCCTTTTGACCACGCGCGT
GTGCGGCTACAGCACAAACCCGAAGGTTCCTGCGACTATGTCAATGCCAGTCACCTCAAGACATCGGGGAGCAAT
AAGCGCTACATTGCCTCTCAAGGCCCCTTGCCAGCCACGTTTGAGGACTTTTGGACCGTTATTTGGGAACAGGAC
GTTCGTGTCGTTGTCATGTTGACGGCCGAGTCAGAAGGCGGACAGTTGAAATGCCATTCATATTGGAAGGGAAGG
GACTTTGGTGCCCTCAAACTGAAAAGCCTGTCAGAAAGAAAGGTTTCTCTCAATCTTGACAAACAGCGGAGCAAT
GACTTCAAGAAAAAAACAAGTATTGCAACGGGCTCCGAGAACTCAACGCCAACAAAAACTTCCGAGAACCAAGAC
GGCCCCTCGCATGCTCCCTACGTCATCGTTCGCAAATTTGCATTATCGCATGCCGCCTATCCCTTTGCGCCTATT
AGGGAGATAACACACCTACACTTCTCATCTTGGCCCGATTTTGGGACCCCCGCCCAACCAGCGCATCTACTGGCC
TTGGTGGAATTGGCCAATTTGACGCAACAGGCTGCATTTCCCGTTGAGACGGCCAATGTTATGAGCTCCATGTCG
ACGTGGCAGCTTCAGGAGCCGGAGAAGAATGCACACACTCGACCCATGTTGGTGCACTGCTCGGCAGGATGCGGC
CGGACTGGTACTTTCTGTACTGTGGACACGGTTATCGACATGATGAAGCGCCTGCAACTTAGCAAAATGGCTGTT
GCTCATCCAAGCAAGGATTTGCAGGGCGACGTGGCTATGACAGACGACCATATCCTGGGCCCACATGGCGCCTTT
CAAGCGCCACATGCTCAGAGCTTTTTCACCCATGACGTGGCTTACCATGATAAAGGCACTTCTCAAATAGACACG
AACTGGATGCATGACGATACGATTGACCTTATCCAGAGAACCGTGGAAGAGTTTCGAGAACAGCGACTCAGCATG
GTACAGACTTTGCGGCAGTACGTTTTGTGCTACGAGACTGTGCTGGAATGGATTTACAGGACCAGCGACCGGAAG
TCTGCAGCCGATGCAACTTCCAGAATGCGGGCTGGTGGTTTTGTCAAGGCTCGACATGAAAGCTGA
Transcript >OphauB2|1533
ATGCTATCCCCCAAGCGGCACCAGGAGGCTCGGGCCTCAAGTCCAAATTATTTTGGCCTTGCCGTTGAGGCGACT
AGTGAATCTCGCGAAACATCAGGCTTAGTACGAGAGAATTGGAACTCGGCCTCGTCTTCGGTCAAGTCCTTTGCC
GCCGCTCTCCCTAAACAAATTCCACTAGAGCCAAACGCCGATTTCGAAGCCTTCAAAAGGCAAGCAGATATTAAT
AGAGGCAAGTCGTTTTCACTTCCTACAGCTCACCAACTGCACCCGCCGTCGCTCGCTACCCCAGTGCGCCCACGA
CCGCCTCGGTGGCATACTCATGTCAGCGATGCCGACTCGGACTCATTTTTCCCGTCAACAACAGCCTTTCGCAAA
GATGGCATCAATGGGCGAATCGATGTTGACCAGGCTAGCCTACATGATTCGGCTTATGTGTCCTCTGATTCCAAG
CGCAACTCTGAAGTGTCCACAATTCCCATGTCAATTACAGGAATGCCCAGGTTCGATTCTCCGCGGCTTTTGGAC
CTTTCACAGTGCCATACTACTACTCTCTCCAAGCCGGATGGGTGCGACAGCAGGTTATCTCTCATGACGAGCAAG
GTTGACCCTCCCTCTCCTCAACCGGCTGATATGAGCCGTGCGGCCACCCTGCCATCAAAACTTGACTCAGCCTCG
CGTATGATGTCGGTTGGCGACCTTAAAGAACTGGTCGATTCGCCAGACAGCCAGCACCTTCTACTCTTGGATATT
CGCTCTTCACAAAGTCACGCCCTGTCGCATATCCGCGGGGCTCTCAACCTGTGCATCCCCACAACGCTACTGAAG
CGGCCAACATTCAATATCCAAAAGCTCCAGCAGACATTTCATGGCGGATCTAGCTCATCGAAATTCTCTAGATGG
CGCGACATGCGATGGATTGTAGTGTACGATGCTCATGCTTCAGACAAGCGCGATGCCGTAACGGCCCAAAACATG
ATCAGAAAGTTTACCAACGAAGGCTATTCGGGAAGCACCGCCATCCTGCGTGGGGGCTTCACTCTCTTTGAAAAG
ACGTACCCGAAACTTGTCGATGAGGGATGCGACTCACCAACATCGCCAAGCCAGTCCAACTCGAATTCACGAGCC
AGCAAAGGCCTCGCTCCCGTCATTGGCGGAGTGAATCTGCCCCAGTCGACTAATGAGCCAGATCCCTTCTTCTCC
AACATTCGGCAAAACATTGACTTGGCTGATGGCGTCGGTCAACTCGAGGTGGCATGGCCTCTAGGTCTGGATTTG
ATGCAGTTGCCACACTGGCTGCGCGATGCAGCCTCTAATTCGGACAAGGGCAAAAGGGTGTCGGACAAGTTTCTC
CGCATCGAACTCGACGAACAGTCGCGAATGAGAAGTGCATACGCTGCCTTTAATCCCAATCTTCGACAAGAGAGC
AAGTTCTATCTATCAGGCGTTGAGAAGGGCTGCAAGAACCGATACAAAGACATCTTGCCTTTTGACCACGCGCGT
GTGCGGCTACAGCACAAACCCGAAGGTTCCTGCGACTATGTCAATGCCAGTCACCTCAAGACATCGGGGAGCAAT
AAGCGCTACATTGCCTCTCAAGGCCCCTTGCCAGCCACGTTTGAGGACTTTTGGACCGTTATTTGGGAACAGGAC
GTTCGTGTCGTTGTCATGTTGACGGCCGAGTCAGAAGGCGGACAGTTGAAATGCCATTCATATTGGAAGGGAAGG
GACTTTGGTGCCCTCAAACTGAAAAGCCTGTCAGAAAGAAAGGTTTCTCTCAATCTTGACAAACAGCGGAGCAAT
GACTTCAAGAAAAAAACAAGTATTGCAACGGGCTCCGAGAACTCAACGCCAACAAAAACTTCCGAGAACCAAGAC
GGCCCCTCGCATGCTCCCTACGTCATCGTTCGCAAATTTGCATTATCGCATGCCGCCTATCCCTTTGCGCCTATT
AGGGAGATAACACACCTACACTTCTCATCTTGGCCCGATTTTGGGACCCCCGCCCAACCAGCGCATCTACTGGCC
TTGGTGGAATTGGCCAATTTGACGCAACAGGCTGCATTTCCCGTTGAGACGGCCAATGTTATGAGCTCCATGTCG
ACGTGGCAGCTTCAGGAGCCGGAGAAGAATGCACACACTCGACCCATGTTGGTGCACTGCTCGGCAGGATGCGGC
CGGACTGGTACTTTCTGTACTGTGGACACGGTTATCGACATGATGAAGCGCCTGCAACTTAGCAAAATGGCTGTT
GCTCATCCAAGCAAGGATTTGCAGGGCGACGTGGCTATGACAGACGACCATATCCTGGGCCCACATGGCGCCTTT
CAAGCGCCACATGCTCAGAGCTTTTTCACCCATGACGTGGCTTACCATGATAAAGGCACTTCTCAAATAGACACG
AACTGGATGCATGACGATACGATTGACCTTATCCAGAGAACCGTGGAAGAGTTTCGAGAACAGCGACTCAGCATG
GTACAGACTTTGCGGCAGTACGTTTTGTGCTACGAGACTGTGCTGGAATGGATTTACAGGACCAGCGACCGGAAG
TCTGCAGCCGATGCAACTTCCAGAATGCGGGCTGGTGGTTTTGTCAAGGCTCGACATGAAAGCTGA
Gene >OphauB2|1533
ATGCTATCCCCCAAGCGGCACCAGGAGGCTCGGGCCTCAAGTCCAAATTATTTTGGCCTTGCCGTTGAGGCGACT
AGTGAATCTCGCGAAACATCAGGCTTAGTACGAGAGAATTGGAACTCGGCCTCGTCTTCGGTCAAGTCCTTTGCC
GCCGCTCTCCCTAAACAAATTCCACTAGAGCCAAACGCCGATTTCGAAGCCTTCAAAAGGCAAGCAGATATTAAT
AGAGGCAAGTCGTTTTCACTTCCTACAGCTCACCAACTGCACCCGCCGTCGCTCGCTACCCCAGTGCGCCCACGA
CCGCCTCGGTGGCATACTCATGTCAGCGATGCCGACTCGGACTCATTTTTCCCGTCAACAACAGCCTTTCGCAAA
GATGGCATCAATGGGCGAATCGATGTTGACCAGGCTAGCCTACATGATTCGGCTTATGTGTCCTCTGATTCCAAG
CGCAACTCTGAAGTGTCCACAATTCCCATGTCAATTACAGGAATGCCCAGGTTCGATTCTCCGCGGCTTTTGGAC
CTTTCACAGTGCCATACTACTACTCTCTCCAAGCCGGATGGGTGCGACAGCAGGTTATCTCTCATGACGAGCAAG
GTTGACCCTCCCTCTCCTCAACCGGCTGATATGAGCCGTGCGGCCACCCTGCCATCAAAACTTGACTCAGCCTCG
CGTATGATGTCGGTTGGCGACCTTAAAGAACTGGTCGATTCGCCAGACAGCCAGCACCTTCTACTCTTGGATATT
CGCTCTTCACAAAGTCACGCCCTGTCGCATATCCGCGGGGCTCTCAACCTGTGCATCCCCACAACGCTACTGAAG
CGGCCAACATTCAATATCCAAAAGCTCCAGCAGACATTTCATGGCGGATCTAGCTCATCGAAATTCTCTAGATGG
CGCGACATGCGATGGATTGTAGTGTACGATGCTCATGCTTCAGACAAGCGCGATGCCGTAACGGCCCAAAACATG
ATCAGAAAGTTTACCAACGAAGGCTATTCGGGAAGCACCGCCATCCTGCGTGGGGGCTTCACTCTCTTTGAAAAG
ACGTACCCGAAACTTGTCGATGAGGGATGCGACTCACCAACATCGCCAAGCCAGTCCAACTCGAATTCACGAGCC
AGCAAAGGCCTCGCTCCCGTCATTGGCGGAGTGAATCTGCCCCAGTCGACTAATGAGCCAGATCCCTTCTTCTCC
AACATTCGGCAAAACATTGACTTGGCTGATGGCGTCGGTCAACTCGAGGTGGCATGGCCTCTAGGTCTGGATTTG
ATGCAGTTGCCACACTGGCTGCGCGATGCAGCCTCTAATTCGGACAAGGGCAAAAGGGTGTCGGACAAGTTTCTC
CGCATCGAACTCGACGAACAGTCGCGAATGAGAAGTGCATACGCTGCCTTTAATCCCAATCTTCGACAAGAGAGC
AAGTTCTATCTATCAGGCGTTGAGAAGGGCTGCAAGAACCGATACAAAGACATCTTGCCTTTTGACCACGCGCGT
GTGCGGCTACAGCACAAACCCGAAGGTTCCTGCGACTATGTCAATGCCAGTCACCTCAAGACATCGGGGAGCAAT
AAGCGCTACATTGCCTCTCAAGGCCCCTTGCCAGCCACGTTTGAGGTAAGCATATGGGCACCATGTCAAAAGGAG
ACGTGTCTAATTGCTGTTTAGGACTTTTGGACCGTTATTTGGGAACAGGACGTTCGTGTCGTTGTCATGTTGACG
GCCGAGTCAGAAGGCGGACAGTTGAAATGCCATTCATATTGGAAGGGAAGGGACTTTGGTGCCCTCAAACTGAAA
AGCCTGTCAGAAAGAAAGGTTTCTCTCAATCTTGACAAACAGCGGAGCAATGACTTCAAGAAAAAAACAAGTATT
GCAACGGGCTCCGAGAACTCAACGCCAACAAAAACTTCCGAGAACCAAGACGGCCCCTCGCATGCTCCCTACGTC
ATCGTTCGCAAATTTGCATTATCGCATGCCGCCTATCCCTTTGCGCCTATTAGGGAGATAACACACCTACACTTC
TCATCTTGGCCCGATTTTGGGACCCCCGCCCAACCAGCGCATCTACTGGCCTTGGTGGAATTGGCCAATTTGACG
CAACAGGCTGCATTTCCCGTTGAGACGGCCAATGTTATGAGCTCCATGTCGACGTGGCAGCTTCAGGAGCCGGAG
AAGAATGCACACACTCGACCCATGTTGGTGCACTGCTCGGCAGGATGCGGCCGGACTGGTACTTTCTGTACTGTG
GACACGGTTATCGACATGATGAAGCGCCTGCAACTTAGCAAAATGGCTGTTGCTCATCCAAGCAAGGATTTGCAG
GGCGACGTGGCTATGACAGACGACCATATCCTGGGCCCACATGGCGCCTTTCAAGCGCCACATGCTCAGAGCTTT
TTCACCCATGACGTGGCTTACCATGATAAAGGCACTTCTCAAATAGACACGAACTGGATGCATGACGATACGATT
GACCTTATCCAGAGAACCGTGGAAGAGTTTCGAGAACAGCGACTCAGCATGGTACAGACTTTGCGGCAGTACGTT
TTGTGCTACGAGACTGTGCTGGAATGGATTTACAGGACCAGCGACCGGAAGTCTGCAGCCGATGCAACTTCCAGA
ATGCGGGCTGGTGGTTTTGTCAAGGCTCGACATGAAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail