Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1532
Gene name
LocationContig_14:256325..257486
Strand-
Gene length (bp)1161
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09347 DUF1989 Domain of unknown function (DUF1989) 2.1E-58 52 227

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10082|YAO3_SCHPO Uncharacterized protein C11D3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.03c PE=4 SV=1 2 293 4.0E-105
sp|O31473|YCGI_BACSU Uncharacterized protein YcgI OS=Bacillus subtilis (strain 168) GN=ycgI PE=4 SV=4 66 234 5.0E-12

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6518
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5133
Ophiocordyceps australis map64 (Brazil) OphauB2|1532 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1161

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1532
MSSIEARLRARDEVPAPSPAYLPQAGSPLTVDAAVYEAIQTAPRVCIHDFELPIRSGRAWEAPAASIVRISTPLG
PQVGDLNIWNLHNARERFWASRTRQLHSSHLTTHDRLWSSLPYLRPLATIIHDSLAWYGTDARGGRVHDLLGTRC
DPYANALLAGPDAAYDYHCHSNLVRAVLPWRLEERDVHDVLNVFQVTGLDQQGRYFMSPCPATKGDCIEFLAEQD
LLMALSTCPGGDLSAWGFGSDNEKDMVKCCRPLRVEVFRLQDSQLLDRLGWKPAELAPYNGMHGIVCPLGDERKS
*
Coding >OphauB2|1532
ATGTCGAGCATTGAGGCGCGACTGCGTGCACGAGACGAGGTGCCGGCCCCGTCGCCGGCCTATCTCCCCCAGGCC
GGGTCGCCGCTTACCGTTGACGCAGCAGTGTACGAAGCGATTCAGACGGCGCCTCGGGTCTGCATCCACGACTTT
GAGCTGCCGATACGGTCGGGGCGGGCCTGGGAGGCGCCGGCAGCGTCCATTGTGCGCATCAGCACGCCTCTCGGG
CCTCAGGTTGGCGACCTCAACATATGGAATCTGCACAATGCGCGCGAGCGCTTCTGGGCCTCTCGCACTCGCCAG
CTGCACTCGTCGCACCTCACGACACACGACCGTCTCTGGTCTTCGTTGCCCTACCTGCGTCCTCTTGCCACCATT
ATCCACGATAGCCTCGCCTGGTATGGCACCGATGCACGCGGCGGGCGGGTGCACGACTTGCTGGGCACGCGGTGC
GATCCCTATGCCAATGCGCTGCTGGCCGGCCCCGACGCAGCCTACGACTACCACTGCCACTCCAACCTGGTCCGC
GCTGTCCTGCCCTGGCGGCTGGAGGAGCGCGATGTGCATGACGTACTCAACGTGTTTCAGGTCACGGGGCTGGAC
CAACAGGGCAGGTATTTCATGAGTCCTTGCCCTGCGACAAAGGGTGATTGTATCGAGTTTCTCGCCGAGCAGGAC
TTGCTCATGGCGCTGAGCACCTGTCCAGGTGGCGATCTCTCGGCTTGGGGCTTTGGTAGCGACAATGAAAAAGAC
ATGGTAAAGTGTTGCCGCCCCCTGCGCGTCGAGGTCTTCCGCCTACAAGACTCGCAACTCCTAGACAGGCTTGGG
TGGAAGCCCGCAGAGCTGGCGCCGTACAATGGCATGCATGGAATTGTTTGTCCATTGGGCGACGAGCGCAAATCG
TAA
Transcript >OphauB2|1532
ATGTCGAGCATTGAGGCGCGACTGCGTGCACGAGACGAGGTGCCGGCCCCGTCGCCGGCCTATCTCCCCCAGGCC
GGGTCGCCGCTTACCGTTGACGCAGCAGTGTACGAAGCGATTCAGACGGCGCCTCGGGTCTGCATCCACGACTTT
GAGCTGCCGATACGGTCGGGGCGGGCCTGGGAGGCGCCGGCAGCGTCCATTGTGCGCATCAGCACGCCTCTCGGG
CCTCAGGTTGGCGACCTCAACATATGGAATCTGCACAATGCGCGCGAGCGCTTCTGGGCCTCTCGCACTCGCCAG
CTGCACTCGTCGCACCTCACGACACACGACCGTCTCTGGTCTTCGTTGCCCTACCTGCGTCCTCTTGCCACCATT
ATCCACGATAGCCTCGCCTGGTATGGCACCGATGCACGCGGCGGGCGGGTGCACGACTTGCTGGGCACGCGGTGC
GATCCCTATGCCAATGCGCTGCTGGCCGGCCCCGACGCAGCCTACGACTACCACTGCCACTCCAACCTGGTCCGC
GCTGTCCTGCCCTGGCGGCTGGAGGAGCGCGATGTGCATGACGTACTCAACGTGTTTCAGGTCACGGGGCTGGAC
CAACAGGGCAGGTATTTCATGAGTCCTTGCCCTGCGACAAAGGGTGATTGTATCGAGTTTCTCGCCGAGCAGGAC
TTGCTCATGGCGCTGAGCACCTGTCCAGGTGGCGATCTCTCGGCTTGGGGCTTTGGTAGCGACAATGAAAAAGAC
ATGGTAAAGTGTTGCCGCCCCCTGCGCGTCGAGGTCTTCCGCCTACAAGACTCGCAACTCCTAGACAGGCTTGGG
TGGAAGCCCGCAGAGCTGGCGCCGTACAATGGCATGCATGGAATTGTTTGTCCATTGGGCGACGAGCGCAAATCG
TAA
Gene >OphauB2|1532
ATGTCGAGCATTGAGGCGCGACTGCGTGCACGAGACGAGGTGCCGGCCCCGTCGCCGGCCTATCTCCCCCAGGCC
GGGTCGCCGCTTACCGTTGACGCAGCAGTGTACGAAGCGATTCAGACGGCGCCTCGGGTCTGCATCCACGACTTT
GAGCTGCCGATACGGTCGGGGCGGGCCTGGGAGGCGCCGGCAGCGTCCATTGTGCGCATCAGCACGCCTCTCGGG
CCTCAGGTTGGTGAGTGCCGTGGCGGGTGCAGAAAAGTCGAGCCCTCGAGCAGCCGACTGACACAGCCTCGCACA
GGCGACCTCAACATATGGAATCTGCACAATGCGCGCGAGCGCTTCTGGGCCTCTCGCACTCGCCAGCTGCACTCG
TCGCACCTCACGACACACGACCGTCTCTGGTCTTCGTTGCCCTACCTGCGTCCTCTTGCCACCATTATCCACGAT
AGCCTCGCCTGGTATGGCACCGATGCACGCGGCGGGCGGGTGCACGACTTGCTGGGCACGCGGTGCGATCCCTAT
GCCAATGCGCTGCTGGCCGGCCCCGACGCAGCCTACGACTACCACTGCCACTCCAACCTGGTCCGCGCTGTCCTG
CCCTGGCGGCTGGAGGAGCGCGATGTGCATGACGTACTCAACGTGTTTCAGGTCACGGGGCTGGACCAACAGGGC
AGGTATTTCATGAGTCCTTGCCCTGCGACAAAGGGTGATTGTATCGAGTTTCTCGCCGAGCAGGACTTGCTCATG
GCGCTGAGTACGTCTAATCTCTTGCTCTCCTGCCCTCGTGGCCCCTTTTGGAGCAGCCTGAGCACCTTGTTTCTG
TATTTGCTGGCCCTTTCTCACCCCTTGGCCTCAATCACACCACCTGGGACATTCTTGTCCTTGTCTTGTTGAGCC
GACAAGGCTTCGCAATGCATAATCCCGCTGACTTCTTTTTCTCTTTCAGGCACCTGTCCAGGTGGCGATCTCTCG
GCTTGGGGCTTTGGTAGCGACAATGAAAAAGACATGGTAAAGTGTTGCCGCCCCCTGCGCGTCGAGGTCTTCCGC
CTACAAGACTCGCAACTCCTAGACAGGCTTGGGTGGAAGCCCGCAGAGCTGGCGCCGTACAATGGCATGCATGGA
ATTGTTTGTCCATTGGGCGACGAGCGCAAATCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail