Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1529
Gene name
LocationContig_14:245467..247153
Strand-
Gene length (bp)1686
Transcript length (bp)1686
Coding sequence length (bp)1686
Protein length (aa) 562

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2227
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1829
Ophiocordyceps australis map64 (Brazil) OphauB2|1529 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03690
Ophiocordyceps camponoti-rufipedis Ophun1|2358
Ophiocordyceps kimflemingae Ophio5|3180
Ophiocordyceps subramaniannii Hirsu2|2847

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1529
MPAVTKFEIPVSCRSFSLYTRLPLELRQNIMAAYLSQAGINFLSIEARDKKWNWETTLPKRHTAVQGLDSLGMAI
ESDMAAPHLVLCSDLVPTASFMQADISNSVRLRHKMNTMKCVGREARLYMKDLASRPGVLRLQIPGRNDIVSLAS
SQDVTFLDYITSELYASDSTLDLYIDCPGLDQIRRVAVRLCHDWRPACSDSTCSEYGKPSHGHEQGPNYPLHLFQ
FLARCFPRLEQVWLVDYHATRNKTKGSGNENEHLRHHELDSHNRMEAHKAHYDAHGLVPLFGALTIDEQDDNEQC
MSPISSSSFNDSGFFEASFSDSGMDQDPLDGALLESMPRVEFETDADDDVIMKDYSDDHDDRYTDALEYLDDKDF
FVPAAEKKKLRQFASQAPRAKNGLQSGIDDIVHGMARLSLKRETGDAWHSYKSPRQIFHAEGRRYYEVRRNDSEW
NITPRARHMCDWLQNNFLQYAKQSTLSRVQAAETVEFGILACKWDIEPPAQPKQRAAHPRHARCTKGAYSMTTWP
VPLPPDAMDLDSSHVFGSGSLDTCSFGFPMDYIEVD*
Coding >OphauB2|1529
ATGCCGGCGGTTACAAAGTTCGAAATTCCGGTGTCGTGCCGTTCATTTAGTCTTTATACACGGCTTCCTCTGGAG
CTGCGCCAAAACATCATGGCTGCCTATCTTTCTCAGGCCGGCATCAACTTTTTGTCGATTGAGGCCCGGGACAAG
AAGTGGAACTGGGAGACGACTTTGCCGAAGCGCCACACAGCGGTCCAGGGTCTCGATAGCCTGGGCATGGCCATT
GAGAGCGACATGGCGGCGCCGCACCTTGTCCTATGCTCAGACCTAGTACCGACGGCATCGTTTATGCAGGCGGAC
ATATCCAACTCGGTCCGGCTTCGGCACAAGATGAACACAATGAAGTGTGTAGGGCGGGAAGCAAGATTGTACATG
AAGGATTTGGCCTCTCGCCCTGGAGTGCTGAGGCTCCAAATTCCTGGACGCAATGACATTGTGTCGCTAGCCTCG
TCACAGGATGTAACCTTTTTGGACTACATCACGTCGGAGCTTTATGCTTCAGACAGCACTTTGGACTTGTACATC
GACTGTCCCGGCTTGGACCAGATTCGCCGTGTGGCAGTTCGCCTTTGTCATGATTGGCGGCCTGCCTGCTCCGAC
TCGACATGCTCAGAATATGGCAAGCCAAGCCACGGCCATGAGCAAGGGCCCAACTATCCACTTCATCTCTTTCAG
TTCCTAGCGCGGTGTTTTCCTCGGCTGGAGCAAGTTTGGCTGGTTGATTATCATGCTACAAGGAACAAGACCAAG
GGCTCGGGTAATGAGAATGAGCATTTGCGGCATCATGAGCTTGACTCTCACAATCGAATGGAGGCGCACAAGGCC
CATTACGACGCCCATGGACTTGTTCCTTTATTTGGTGCCTTGACGATTGACGAGCAAGACGACAATGAACAATGC
ATGAGCCCCATATCGTCGTCGTCTTTCAATGACTCGGGTTTTTTCGAAGCTTCCTTCAGCGACTCTGGTATGGAC
CAGGACCCTTTAGATGGTGCACTTCTGGAGTCGATGCCGAGAGTCGAGTTTGAGACGGACGCAGACGACGACGTC
ATCATGAAGGACTATAGCGATGACCACGATGACAGATATACTGATGCGCTGGAGTATCTGGATGACAAGGATTTC
TTTGTGCCTGCAGCTGAGAAGAAGAAATTGAGGCAGTTTGCAAGCCAGGCACCCAGGGCAAAGAATGGCTTGCAA
AGTGGCATTGACGACATTGTGCATGGCATGGCCAGATTGAGCCTGAAGCGGGAGACTGGTGACGCTTGGCACAGC
TATAAAAGCCCACGTCAGATATTCCACGCTGAGGGCCGGCGCTACTACGAGGTGCGGCGAAATGACAGCGAATGG
AACATTACACCTAGGGCTCGACACATGTGCGACTGGCTTCAAAACAACTTTTTGCAATATGCCAAGCAGAGCACC
TTGTCGCGCGTACAGGCTGCTGAGACGGTTGAATTTGGCATCTTGGCGTGCAAGTGGGACATTGAGCCCCCGGCG
CAACCCAAGCAAAGGGCAGCGCATCCTCGACACGCACGATGTACAAAAGGGGCATACTCCATGACGACATGGCCC
GTGCCGTTGCCACCTGATGCTATGGACTTGGATTCGAGTCATGTCTTTGGCTCGGGCTCTCTTGACACTTGCTCT
TTTGGCTTTCCCATGGACTATATCGAGGTGGACTGA
Transcript >OphauB2|1529
ATGCCGGCGGTTACAAAGTTCGAAATTCCGGTGTCGTGCCGTTCATTTAGTCTTTATACACGGCTTCCTCTGGAG
CTGCGCCAAAACATCATGGCTGCCTATCTTTCTCAGGCCGGCATCAACTTTTTGTCGATTGAGGCCCGGGACAAG
AAGTGGAACTGGGAGACGACTTTGCCGAAGCGCCACACAGCGGTCCAGGGTCTCGATAGCCTGGGCATGGCCATT
GAGAGCGACATGGCGGCGCCGCACCTTGTCCTATGCTCAGACCTAGTACCGACGGCATCGTTTATGCAGGCGGAC
ATATCCAACTCGGTCCGGCTTCGGCACAAGATGAACACAATGAAGTGTGTAGGGCGGGAAGCAAGATTGTACATG
AAGGATTTGGCCTCTCGCCCTGGAGTGCTGAGGCTCCAAATTCCTGGACGCAATGACATTGTGTCGCTAGCCTCG
TCACAGGATGTAACCTTTTTGGACTACATCACGTCGGAGCTTTATGCTTCAGACAGCACTTTGGACTTGTACATC
GACTGTCCCGGCTTGGACCAGATTCGCCGTGTGGCAGTTCGCCTTTGTCATGATTGGCGGCCTGCCTGCTCCGAC
TCGACATGCTCAGAATATGGCAAGCCAAGCCACGGCCATGAGCAAGGGCCCAACTATCCACTTCATCTCTTTCAG
TTCCTAGCGCGGTGTTTTCCTCGGCTGGAGCAAGTTTGGCTGGTTGATTATCATGCTACAAGGAACAAGACCAAG
GGCTCGGGTAATGAGAATGAGCATTTGCGGCATCATGAGCTTGACTCTCACAATCGAATGGAGGCGCACAAGGCC
CATTACGACGCCCATGGACTTGTTCCTTTATTTGGTGCCTTGACGATTGACGAGCAAGACGACAATGAACAATGC
ATGAGCCCCATATCGTCGTCGTCTTTCAATGACTCGGGTTTTTTCGAAGCTTCCTTCAGCGACTCTGGTATGGAC
CAGGACCCTTTAGATGGTGCACTTCTGGAGTCGATGCCGAGAGTCGAGTTTGAGACGGACGCAGACGACGACGTC
ATCATGAAGGACTATAGCGATGACCACGATGACAGATATACTGATGCGCTGGAGTATCTGGATGACAAGGATTTC
TTTGTGCCTGCAGCTGAGAAGAAGAAATTGAGGCAGTTTGCAAGCCAGGCACCCAGGGCAAAGAATGGCTTGCAA
AGTGGCATTGACGACATTGTGCATGGCATGGCCAGATTGAGCCTGAAGCGGGAGACTGGTGACGCTTGGCACAGC
TATAAAAGCCCACGTCAGATATTCCACGCTGAGGGCCGGCGCTACTACGAGGTGCGGCGAAATGACAGCGAATGG
AACATTACACCTAGGGCTCGACACATGTGCGACTGGCTTCAAAACAACTTTTTGCAATATGCCAAGCAGAGCACC
TTGTCGCGCGTACAGGCTGCTGAGACGGTTGAATTTGGCATCTTGGCGTGCAAGTGGGACATTGAGCCCCCGGCG
CAACCCAAGCAAAGGGCAGCGCATCCTCGACACGCACGATGTACAAAAGGGGCATACTCCATGACGACATGGCCC
GTGCCGTTGCCACCTGATGCTATGGACTTGGATTCGAGTCATGTCTTTGGCTCGGGCTCTCTTGACACTTGCTCT
TTTGGCTTTCCCATGGACTATATCGAGGTGGACTGA
Gene >OphauB2|1529
ATGCCGGCGGTTACAAAGTTCGAAATTCCGGTGTCGTGCCGTTCATTTAGTCTTTATACACGGCTTCCTCTGGAG
CTGCGCCAAAACATCATGGCTGCCTATCTTTCTCAGGCCGGCATCAACTTTTTGTCGATTGAGGCCCGGGACAAG
AAGTGGAACTGGGAGACGACTTTGCCGAAGCGCCACACAGCGGTCCAGGGTCTCGATAGCCTGGGCATGGCCATT
GAGAGCGACATGGCGGCGCCGCACCTTGTCCTATGCTCAGACCTAGTACCGACGGCATCGTTTATGCAGGCGGAC
ATATCCAACTCGGTCCGGCTTCGGCACAAGATGAACACAATGAAGTGTGTAGGGCGGGAAGCAAGATTGTACATG
AAGGATTTGGCCTCTCGCCCTGGAGTGCTGAGGCTCCAAATTCCTGGACGCAATGACATTGTGTCGCTAGCCTCG
TCACAGGATGTAACCTTTTTGGACTACATCACGTCGGAGCTTTATGCTTCAGACAGCACTTTGGACTTGTACATC
GACTGTCCCGGCTTGGACCAGATTCGCCGTGTGGCAGTTCGCCTTTGTCATGATTGGCGGCCTGCCTGCTCCGAC
TCGACATGCTCAGAATATGGCAAGCCAAGCCACGGCCATGAGCAAGGGCCCAACTATCCACTTCATCTCTTTCAG
TTCCTAGCGCGGTGTTTTCCTCGGCTGGAGCAAGTTTGGCTGGTTGATTATCATGCTACAAGGAACAAGACCAAG
GGCTCGGGTAATGAGAATGAGCATTTGCGGCATCATGAGCTTGACTCTCACAATCGAATGGAGGCGCACAAGGCC
CATTACGACGCCCATGGACTTGTTCCTTTATTTGGTGCCTTGACGATTGACGAGCAAGACGACAATGAACAATGC
ATGAGCCCCATATCGTCGTCGTCTTTCAATGACTCGGGTTTTTTCGAAGCTTCCTTCAGCGACTCTGGTATGGAC
CAGGACCCTTTAGATGGTGCACTTCTGGAGTCGATGCCGAGAGTCGAGTTTGAGACGGACGCAGACGACGACGTC
ATCATGAAGGACTATAGCGATGACCACGATGACAGATATACTGATGCGCTGGAGTATCTGGATGACAAGGATTTC
TTTGTGCCTGCAGCTGAGAAGAAGAAATTGAGGCAGTTTGCAAGCCAGGCACCCAGGGCAAAGAATGGCTTGCAA
AGTGGCATTGACGACATTGTGCATGGCATGGCCAGATTGAGCCTGAAGCGGGAGACTGGTGACGCTTGGCACAGC
TATAAAAGCCCACGTCAGATATTCCACGCTGAGGGCCGGCGCTACTACGAGGTGCGGCGAAATGACAGCGAATGG
AACATTACACCTAGGGCTCGACACATGTGCGACTGGCTTCAAAACAACTTTTTGCAATATGCCAAGCAGAGCACC
TTGTCGCGCGTACAGGCTGCTGAGACGGTTGAATTTGGCATCTTGGCGTGCAAGTGGGACATTGAGCCCCCGGCG
CAACCCAAGCAAAGGGCAGCGCATCCTCGACACGCACGATGTACAAAAGGGGCATACTCCATGACGACATGGCCC
GTGCCGTTGCCACCTGATGCTATGGACTTGGATTCGAGTCATGTCTTTGGCTCGGGCTCTCTTGACACTTGCTCT
TTTGGCTTTCCCATGGACTATATCGAGGTGGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail