Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1528
Gene name
LocationContig_14:243120..244689
Strand+
Gene length (bp)1569
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 1.6E-08 111 202
PF02102 Peptidase_M35 Deuterolysin metalloprotease (M35) family 1.7E-09 52 174

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 93 306 3.0E-07
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 70 312 5.0E-06

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008233 peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0004175 endopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1528
MKSTLLLAVASTALAQLGSKVPEDLTVVADRGGASRPLRRQVSPVLGSKLLSDDLTVISDSGRSGSEGSVERRAE
QANDCGTKPNRANVDSSKFVDKSLDDCTRMARAAAAAADDESSPLVRAFFKRDTAEVRAKVGGLFRAIEQECGKP
QAGESVVTCVDRLGDCNTGASAVTRWGGGQGTSVLLCDQFFNHGFVEKQSTTQTDKNPNQEANSRSRRRSLLNRR
QQAAGDVKATERPMCARLDPSGIMLHEMTHAIGHTTDDGGPPKTNFADGTAKYGLQAVGSMPAELNINHADTYAL
FAHAASLNCTEQDLVSGGPPSGEANPAGPAGGTNSTDETAPGGRKKKKGPTTQPIGDDEGGDPTGGLPNGDPTNG
LPTSGRPNPDLPNSGLPNEDPTLGNPPGQGQLPPFGTPQGNDPFGSPQGNDPFGSPQGNDPSASPQGNDPSASPQ
GSPLGDPNGLDEEILRQIAGVLAASENDAPSAPSGQVFTSATDSSSQLPPELADLISGVASNINAIPVGGDF*
Coding >OphauB2|1528
ATGAAGTCGACTCTCTTGCTTGCCGTGGCCTCGACAGCGCTGGCGCAGCTGGGCTCCAAGGTGCCTGAGGACCTG
ACTGTTGTTGCGGACCGCGGCGGGGCCTCGCGCCCCCTGAGACGACAGGTGTCGCCGGTGCTGGGCTCCAAGCTG
CTCAGCGACGACCTGACAGTCATCTCCGACTCTGGCAGGTCGGGCAGCGAGGGCAGCGTAGAGCGGCGGGCTGAG
CAGGCCAATGACTGCGGCACCAAGCCCAACCGGGCCAACGTGGACTCGAGCAAGTTTGTCGACAAGAGTCTCGAC
GACTGCACGCGCATGGCTCGGGCGGCGGCAGCAGCAGCCGACGACGAGAGCTCGCCGCTTGTGCGGGCCTTCTTC
AAGCGCGACACGGCCGAGGTGCGGGCCAAGGTGGGTGGGCTGTTCCGGGCCATCGAACAGGAGTGCGGCAAGCCA
CAGGCGGGCGAGAGCGTCGTGACGTGTGTGGACCGCCTGGGCGACTGTAACACGGGTGCCAGTGCCGTAACGCGC
TGGGGAGGTGGCCAGGGCACGTCGGTGCTGCTCTGTGACCAGTTCTTCAACCACGGCTTTGTCGAGAAGCAGTCC
ACCACCCAGACGGACAAGAACCCCAACCAAGAGGCCAACAGCCGCTCTCGACGCCGCAGCCTGCTGAACCGCCGC
CAGCAGGCCGCCGGCGACGTCAAGGCCACTGAACGGCCCATGTGCGCCCGTCTCGACCCCAGCGGCATCATGCTT
CACGAGATGACGCATGCCATTGGCCACACCACCGACGACGGCGGTCCTCCCAAGACCAACTTTGCCGACGGCACG
GCCAAGTACGGCCTCCAGGCTGTCGGCAGCATGCCCGCCGAGTTGAACATTAACCACGCCGACACCTATGCCCTC
TTTGCCCATGCCGCCTCGCTCAACTGCACCGAGCAGGATTTGGTCTCTGGTGGTCCCCCCTCGGGCGAGGCCAAC
CCGGCCGGTCCGGCTGGCGGCACCAACTCTACCGACGAGACTGCTCCTGGCGGCAGGAAGAAGAAGAAGGGTCCC
ACCACGCAGCCTATTGGCGATGATGAAGGCGGTGACCCTACCGGTGGCCTCCCCAACGGCGATCCTACCAATGGG
CTTCCTACCAGTGGCCGCCCCAACCCGGATCTGCCCAACTCGGGTCTGCCCAACGAGGACCCAACTTTAGGCAAT
CCGCCCGGCCAGGGCCAGCTTCCCCCCTTTGGCACCCCTCAGGGCAATGATCCCTTTGGCTCGCCCCAGGGCAAT
GATCCCTTTGGTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAA
GGCTCACCCCTGGGCGACCCCAACGGCCTCGACGAGGAAATCCTTCGACAGATTGCTGGTGTCCTTGCGGCCTCG
GAGAACGATGCCCCCTCGGCCCCGTCTGGCCAAGTATTCACTTCTGCGACAGACTCTTCTTCCCAGCTCCCGCCC
GAGTTGGCCGACCTCATTTCTGGTGTCGCGTCCAACATCAATGCCATTCCTGTTGGAGGCGACTTTTAA
Transcript >OphauB2|1528
ATGAAGTCGACTCTCTTGCTTGCCGTGGCCTCGACAGCGCTGGCGCAGCTGGGCTCCAAGGTGCCTGAGGACCTG
ACTGTTGTTGCGGACCGCGGCGGGGCCTCGCGCCCCCTGAGACGACAGGTGTCGCCGGTGCTGGGCTCCAAGCTG
CTCAGCGACGACCTGACAGTCATCTCCGACTCTGGCAGGTCGGGCAGCGAGGGCAGCGTAGAGCGGCGGGCTGAG
CAGGCCAATGACTGCGGCACCAAGCCCAACCGGGCCAACGTGGACTCGAGCAAGTTTGTCGACAAGAGTCTCGAC
GACTGCACGCGCATGGCTCGGGCGGCGGCAGCAGCAGCCGACGACGAGAGCTCGCCGCTTGTGCGGGCCTTCTTC
AAGCGCGACACGGCCGAGGTGCGGGCCAAGGTGGGTGGGCTGTTCCGGGCCATCGAACAGGAGTGCGGCAAGCCA
CAGGCGGGCGAGAGCGTCGTGACGTGTGTGGACCGCCTGGGCGACTGTAACACGGGTGCCAGTGCCGTAACGCGC
TGGGGAGGTGGCCAGGGCACGTCGGTGCTGCTCTGTGACCAGTTCTTCAACCACGGCTTTGTCGAGAAGCAGTCC
ACCACCCAGACGGACAAGAACCCCAACCAAGAGGCCAACAGCCGCTCTCGACGCCGCAGCCTGCTGAACCGCCGC
CAGCAGGCCGCCGGCGACGTCAAGGCCACTGAACGGCCCATGTGCGCCCGTCTCGACCCCAGCGGCATCATGCTT
CACGAGATGACGCATGCCATTGGCCACACCACCGACGACGGCGGTCCTCCCAAGACCAACTTTGCCGACGGCACG
GCCAAGTACGGCCTCCAGGCTGTCGGCAGCATGCCCGCCGAGTTGAACATTAACCACGCCGACACCTATGCCCTC
TTTGCCCATGCCGCCTCGCTCAACTGCACCGAGCAGGATTTGGTCTCTGGTGGTCCCCCCTCGGGCGAGGCCAAC
CCGGCCGGTCCGGCTGGCGGCACCAACTCTACCGACGAGACTGCTCCTGGCGGCAGGAAGAAGAAGAAGGGTCCC
ACCACGCAGCCTATTGGCGATGATGAAGGCGGTGACCCTACCGGTGGCCTCCCCAACGGCGATCCTACCAATGGG
CTTCCTACCAGTGGCCGCCCCAACCCGGATCTGCCCAACTCGGGTCTGCCCAACGAGGACCCAACTTTAGGCAAT
CCGCCCGGCCAGGGCCAGCTTCCCCCCTTTGGCACCCCTCAGGGCAATGATCCCTTTGGCTCGCCCCAGGGCAAT
GATCCCTTTGGTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAA
GGCTCACCCCTGGGCGACCCCAACGGCCTCGACGAGGAAATCCTTCGACAGATTGCTGGTGTCCTTGCGGCCTCG
GAGAACGATGCCCCCTCGGCCCCGTCTGGCCAAGTATTCACTTCTGCGACAGACTCTTCTTCCCAGCTCCCGCCC
GAGTTGGCCGACCTCATTTCTGGTGTCGCGTCCAACATCAATGCCATTCCTGTTGGAGGCGACTTTTAA
Gene >OphauB2|1528
ATGAAGTCGACTCTCTTGCTTGCCGTGGCCTCGACAGCGCTGGCGCAGCTGGGCTCCAAGGTGCCTGAGGACCTG
ACTGTTGTTGCGGACCGCGGCGGGGCCTCGCGCCCCCTGAGACGACAGGTGTCGCCGGTGCTGGGCTCCAAGCTG
CTCAGCGACGACCTGACAGTCATCTCCGACTCTGGCAGGTCGGGCAGCGAGGGCAGCGTAGAGCGGCGGGCTGAG
CAGGCCAATGACTGCGGCACCAAGCCCAACCGGGCCAACGTGGACTCGAGCAAGTTTGTCGACAAGAGTCTCGAC
GACTGCACGCGCATGGCTCGGGCGGCGGCAGCAGCAGCCGACGACGAGAGCTCGCCGCTTGTGCGGGCCTTCTTC
AAGCGCGACACGGCCGAGGTGCGGGCCAAGGTGGGTGGGCTGTTCCGGGCCATCGAACAGGAGTGCGGCAAGCCA
CAGGCGGGCGAGAGCGTCGTGACGTGTGTGGACCGCCTGGGCGACTGTAACACGGGTGCCAGTGCCGTAACGCGC
TGGGGAGGTGGCCAGGGCACGTCGGTGCTGCTCTGTGACCAGTTCTTCAACCACGGCTTTGTCGAGAAGCAGTCC
ACCACCCAGACGGACAAGAACCCCAACCAAGAGGCCAACAGCCGCTCTCGACGCCGCAGCCTGCTGAACCGCCGC
CAGCAGGCCGCCGGCGACGTCAAGGCCACTGAACGGCCCATGTGCGCCCGTCTCGACCCCAGCGGCATCATGCTT
CACGAGATGACGCATGCCATTGGCCACACCACCGACGACGGCGGTCCTCCCAAGACCAACTTTGCCGACGGCACG
GCCAAGTACGGCCTCCAGGCTGTCGGCAGCATGCCCGCCGAGTTGAACATTAACCACGCCGACACCTATGCCCTC
TTTGCCCATGCCGCCTCGCTCAACTGCACCGAGCAGGATTTGGTCTCTGGTGGTCCCCCCTCGGGCGAGGCCAAC
CCGGCCGGTCCGGCTGGCGGCACCAACTCTACCGACGAGACTGCTCCTGGCGGCAGGAAGAAGAAGAAGGGTCCC
ACCACGCAGCCTATTGGCGATGATGAAGGCGGTGACCCTACCGGTGGCCTCCCCAACGGCGATCCTACCAATGGG
CTTCCTACCAGTGGCCGCCCCAACCCGGATCTGCCCAACTCGGGTCTGCCCAACGAGGACCCAACTTTAGGCAAT
CCGCCCGGCCAGGGCCAGCTTCCCCCCTTTGGCACCCCTCAGGGCAATGATCCCTTTGGCTCGCCCCAGGGCAAT
GATCCCTTTGGTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAA
GGCTCACCCCTGGGCGACCCCAACGGCCTCGACGAGGAAATCCTTCGACAGATTGCTGGTGTCCTTGCGGCCTCG
GAGAACGATGCCCCCTCGGCCCCGTCTGGCCAAGTATTCACTTCTGCGACAGACTCTTCTTCCCAGCTCCCGCCC
GAGTTGGCCGACCTCATTTCTGGTGTCGCGTCCAACATCAATGCCATTCCTGTTGGAGGCGACTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail