Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1528
Gene name
LocationContig_14:243120..244689
Strand+
Gene length (bp)1569
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14521 Aspzincin_M35 Lysine-specific metallo-endopeptidase 1.6E-08 111 202
PF02102 Peptidase_M35 Deuterolysin metalloprotease (M35) family 1.7E-09 52 174

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C4JH04|NPIIC_UNCRE Neutral protease 2 homolog UREG_01255 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_01255 PE=3 SV=1 93 306 3.0E-07
sp|Q4WA45|NPIIC_ASPFU Neutral protease 2 homolog AFUB_070680 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G02700 PE=3 SV=3 70 312 5.0E-06

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0008233 peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0004175 endopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.999609

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup526
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1025
Ophiocordyceps australis 1348a (Ghana) OphauG2|5834
Ophiocordyceps australis 1348a (Ghana) OphauG2|6932
Ophiocordyceps australis map64 (Brazil) OphauB2|1528 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|158
Ophiocordyceps australis map64 (Brazil) OphauB2|408
Ophiocordyceps australis map64 (Brazil) OphauB2|4117
Ophiocordyceps subramaniannii Hirsu2|2978

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1528
MKSTLLLAVASTALAQLGSKVPEDLTVVADRGGASRPLRRQVSPVLGSKLLSDDLTVISDSGRSGSEGSVERRAE
QANDCGTKPNRANVDSSKFVDKSLDDCTRMARAAAAAADDESSPLVRAFFKRDTAEVRAKVGGLFRAIEQECGKP
QAGESVVTCVDRLGDCNTGASAVTRWGGGQGTSVLLCDQFFNHGFVEKQSTTQTDKNPNQEANSRSRRRSLLNRR
QQAAGDVKATERPMCARLDPSGIMLHEMTHAIGHTTDDGGPPKTNFADGTAKYGLQAVGSMPAELNINHADTYAL
FAHAASLNCTEQDLVSGGPPSGEANPAGPAGGTNSTDETAPGGRKKKKGPTTQPIGDDEGGDPTGGLPNGDPTNG
LPTSGRPNPDLPNSGLPNEDPTLGNPPGQGQLPPFGTPQGNDPFGSPQGNDPFGSPQGNDPSASPQGNDPSASPQ
GSPLGDPNGLDEEILRQIAGVLAASENDAPSAPSGQVFTSATDSSSQLPPELADLISGVASNINAIPVGGDF*
Coding >OphauB2|1528
ATGAAGTCGACTCTCTTGCTTGCCGTGGCCTCGACAGCGCTGGCGCAGCTGGGCTCCAAGGTGCCTGAGGACCTG
ACTGTTGTTGCGGACCGCGGCGGGGCCTCGCGCCCCCTGAGACGACAGGTGTCGCCGGTGCTGGGCTCCAAGCTG
CTCAGCGACGACCTGACAGTCATCTCCGACTCTGGCAGGTCGGGCAGCGAGGGCAGCGTAGAGCGGCGGGCTGAG
CAGGCCAATGACTGCGGCACCAAGCCCAACCGGGCCAACGTGGACTCGAGCAAGTTTGTCGACAAGAGTCTCGAC
GACTGCACGCGCATGGCTCGGGCGGCGGCAGCAGCAGCCGACGACGAGAGCTCGCCGCTTGTGCGGGCCTTCTTC
AAGCGCGACACGGCCGAGGTGCGGGCCAAGGTGGGTGGGCTGTTCCGGGCCATCGAACAGGAGTGCGGCAAGCCA
CAGGCGGGCGAGAGCGTCGTGACGTGTGTGGACCGCCTGGGCGACTGTAACACGGGTGCCAGTGCCGTAACGCGC
TGGGGAGGTGGCCAGGGCACGTCGGTGCTGCTCTGTGACCAGTTCTTCAACCACGGCTTTGTCGAGAAGCAGTCC
ACCACCCAGACGGACAAGAACCCCAACCAAGAGGCCAACAGCCGCTCTCGACGCCGCAGCCTGCTGAACCGCCGC
CAGCAGGCCGCCGGCGACGTCAAGGCCACTGAACGGCCCATGTGCGCCCGTCTCGACCCCAGCGGCATCATGCTT
CACGAGATGACGCATGCCATTGGCCACACCACCGACGACGGCGGTCCTCCCAAGACCAACTTTGCCGACGGCACG
GCCAAGTACGGCCTCCAGGCTGTCGGCAGCATGCCCGCCGAGTTGAACATTAACCACGCCGACACCTATGCCCTC
TTTGCCCATGCCGCCTCGCTCAACTGCACCGAGCAGGATTTGGTCTCTGGTGGTCCCCCCTCGGGCGAGGCCAAC
CCGGCCGGTCCGGCTGGCGGCACCAACTCTACCGACGAGACTGCTCCTGGCGGCAGGAAGAAGAAGAAGGGTCCC
ACCACGCAGCCTATTGGCGATGATGAAGGCGGTGACCCTACCGGTGGCCTCCCCAACGGCGATCCTACCAATGGG
CTTCCTACCAGTGGCCGCCCCAACCCGGATCTGCCCAACTCGGGTCTGCCCAACGAGGACCCAACTTTAGGCAAT
CCGCCCGGCCAGGGCCAGCTTCCCCCCTTTGGCACCCCTCAGGGCAATGATCCCTTTGGCTCGCCCCAGGGCAAT
GATCCCTTTGGTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAA
GGCTCACCCCTGGGCGACCCCAACGGCCTCGACGAGGAAATCCTTCGACAGATTGCTGGTGTCCTTGCGGCCTCG
GAGAACGATGCCCCCTCGGCCCCGTCTGGCCAAGTATTCACTTCTGCGACAGACTCTTCTTCCCAGCTCCCGCCC
GAGTTGGCCGACCTCATTTCTGGTGTCGCGTCCAACATCAATGCCATTCCTGTTGGAGGCGACTTTTAA
Transcript >OphauB2|1528
ATGAAGTCGACTCTCTTGCTTGCCGTGGCCTCGACAGCGCTGGCGCAGCTGGGCTCCAAGGTGCCTGAGGACCTG
ACTGTTGTTGCGGACCGCGGCGGGGCCTCGCGCCCCCTGAGACGACAGGTGTCGCCGGTGCTGGGCTCCAAGCTG
CTCAGCGACGACCTGACAGTCATCTCCGACTCTGGCAGGTCGGGCAGCGAGGGCAGCGTAGAGCGGCGGGCTGAG
CAGGCCAATGACTGCGGCACCAAGCCCAACCGGGCCAACGTGGACTCGAGCAAGTTTGTCGACAAGAGTCTCGAC
GACTGCACGCGCATGGCTCGGGCGGCGGCAGCAGCAGCCGACGACGAGAGCTCGCCGCTTGTGCGGGCCTTCTTC
AAGCGCGACACGGCCGAGGTGCGGGCCAAGGTGGGTGGGCTGTTCCGGGCCATCGAACAGGAGTGCGGCAAGCCA
CAGGCGGGCGAGAGCGTCGTGACGTGTGTGGACCGCCTGGGCGACTGTAACACGGGTGCCAGTGCCGTAACGCGC
TGGGGAGGTGGCCAGGGCACGTCGGTGCTGCTCTGTGACCAGTTCTTCAACCACGGCTTTGTCGAGAAGCAGTCC
ACCACCCAGACGGACAAGAACCCCAACCAAGAGGCCAACAGCCGCTCTCGACGCCGCAGCCTGCTGAACCGCCGC
CAGCAGGCCGCCGGCGACGTCAAGGCCACTGAACGGCCCATGTGCGCCCGTCTCGACCCCAGCGGCATCATGCTT
CACGAGATGACGCATGCCATTGGCCACACCACCGACGACGGCGGTCCTCCCAAGACCAACTTTGCCGACGGCACG
GCCAAGTACGGCCTCCAGGCTGTCGGCAGCATGCCCGCCGAGTTGAACATTAACCACGCCGACACCTATGCCCTC
TTTGCCCATGCCGCCTCGCTCAACTGCACCGAGCAGGATTTGGTCTCTGGTGGTCCCCCCTCGGGCGAGGCCAAC
CCGGCCGGTCCGGCTGGCGGCACCAACTCTACCGACGAGACTGCTCCTGGCGGCAGGAAGAAGAAGAAGGGTCCC
ACCACGCAGCCTATTGGCGATGATGAAGGCGGTGACCCTACCGGTGGCCTCCCCAACGGCGATCCTACCAATGGG
CTTCCTACCAGTGGCCGCCCCAACCCGGATCTGCCCAACTCGGGTCTGCCCAACGAGGACCCAACTTTAGGCAAT
CCGCCCGGCCAGGGCCAGCTTCCCCCCTTTGGCACCCCTCAGGGCAATGATCCCTTTGGCTCGCCCCAGGGCAAT
GATCCCTTTGGTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAA
GGCTCACCCCTGGGCGACCCCAACGGCCTCGACGAGGAAATCCTTCGACAGATTGCTGGTGTCCTTGCGGCCTCG
GAGAACGATGCCCCCTCGGCCCCGTCTGGCCAAGTATTCACTTCTGCGACAGACTCTTCTTCCCAGCTCCCGCCC
GAGTTGGCCGACCTCATTTCTGGTGTCGCGTCCAACATCAATGCCATTCCTGTTGGAGGCGACTTTTAA
Gene >OphauB2|1528
ATGAAGTCGACTCTCTTGCTTGCCGTGGCCTCGACAGCGCTGGCGCAGCTGGGCTCCAAGGTGCCTGAGGACCTG
ACTGTTGTTGCGGACCGCGGCGGGGCCTCGCGCCCCCTGAGACGACAGGTGTCGCCGGTGCTGGGCTCCAAGCTG
CTCAGCGACGACCTGACAGTCATCTCCGACTCTGGCAGGTCGGGCAGCGAGGGCAGCGTAGAGCGGCGGGCTGAG
CAGGCCAATGACTGCGGCACCAAGCCCAACCGGGCCAACGTGGACTCGAGCAAGTTTGTCGACAAGAGTCTCGAC
GACTGCACGCGCATGGCTCGGGCGGCGGCAGCAGCAGCCGACGACGAGAGCTCGCCGCTTGTGCGGGCCTTCTTC
AAGCGCGACACGGCCGAGGTGCGGGCCAAGGTGGGTGGGCTGTTCCGGGCCATCGAACAGGAGTGCGGCAAGCCA
CAGGCGGGCGAGAGCGTCGTGACGTGTGTGGACCGCCTGGGCGACTGTAACACGGGTGCCAGTGCCGTAACGCGC
TGGGGAGGTGGCCAGGGCACGTCGGTGCTGCTCTGTGACCAGTTCTTCAACCACGGCTTTGTCGAGAAGCAGTCC
ACCACCCAGACGGACAAGAACCCCAACCAAGAGGCCAACAGCCGCTCTCGACGCCGCAGCCTGCTGAACCGCCGC
CAGCAGGCCGCCGGCGACGTCAAGGCCACTGAACGGCCCATGTGCGCCCGTCTCGACCCCAGCGGCATCATGCTT
CACGAGATGACGCATGCCATTGGCCACACCACCGACGACGGCGGTCCTCCCAAGACCAACTTTGCCGACGGCACG
GCCAAGTACGGCCTCCAGGCTGTCGGCAGCATGCCCGCCGAGTTGAACATTAACCACGCCGACACCTATGCCCTC
TTTGCCCATGCCGCCTCGCTCAACTGCACCGAGCAGGATTTGGTCTCTGGTGGTCCCCCCTCGGGCGAGGCCAAC
CCGGCCGGTCCGGCTGGCGGCACCAACTCTACCGACGAGACTGCTCCTGGCGGCAGGAAGAAGAAGAAGGGTCCC
ACCACGCAGCCTATTGGCGATGATGAAGGCGGTGACCCTACCGGTGGCCTCCCCAACGGCGATCCTACCAATGGG
CTTCCTACCAGTGGCCGCCCCAACCCGGATCTGCCCAACTCGGGTCTGCCCAACGAGGACCCAACTTTAGGCAAT
CCGCCCGGCCAGGGCCAGCTTCCCCCCTTTGGCACCCCTCAGGGCAATGATCCCTTTGGCTCGCCCCAGGGCAAT
GATCCCTTTGGTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAAGGCAATGATCCCTCTGCTTCACCCCAA
GGCTCACCCCTGGGCGACCCCAACGGCCTCGACGAGGAAATCCTTCGACAGATTGCTGGTGTCCTTGCGGCCTCG
GAGAACGATGCCCCCTCGGCCCCGTCTGGCCAAGTATTCACTTCTGCGACAGACTCTTCTTCCCAGCTCCCGCCC
GAGTTGGCCGACCTCATTTCTGGTGTCGCGTCCAACATCAATGCCATTCCTGTTGGAGGCGACTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail