Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1520
Gene name
LocationContig_14:202919..204059
Strand-
Gene length (bp)1140
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09451 ATG27 Autophagy-related protein 27 2.0E-95 13 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B086|ATG27_ARTBC Autophagy-related protein 27 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01857 PE=1 SV=1 6 291 5.0E-32
sp|Q6CBS9|ATG27_YARLI Autophagy-related protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG27 PE=3 SV=1 242 345 6.0E-24
sp|A7KAK7|ATG27_PICAN Autophagy-related protein 27 OS=Pichia angusta GN=ATG27 PE=3 SV=1 237 345 5.0E-12
sp|Q5A5S7|ATG27_CANAL Autophagy-related protein 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG27 PE=3 SV=1 9 345 3.0E-10
sp|A5DE01|ATG27_PICGU Autophagy-related protein 27 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG27 PE=3 SV=2 21 345 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B086|ATG27_ARTBC Autophagy-related protein 27 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01857 PE=1 SV=1 6 291 5.0E-32
sp|Q6CBS9|ATG27_YARLI Autophagy-related protein 27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG27 PE=3 SV=1 242 345 6.0E-24
sp|A7KAK7|ATG27_PICAN Autophagy-related protein 27 OS=Pichia angusta GN=ATG27 PE=3 SV=1 237 345 5.0E-12
sp|Q5A5S7|ATG27_CANAL Autophagy-related protein 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG27 PE=3 SV=1 9 345 3.0E-10
sp|A5DE01|ATG27_PICGU Autophagy-related protein 27 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG27 PE=3 SV=2 21 345 1.0E-07
sp|Q6BM18|ATG27_DEBHA Autophagy-related protein 27 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG27 PE=3 SV=2 36 345 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 274 296 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1520
MRGPQLSALALSLLLTRNLGAAMLRCDNVRVDGHSFDLSKLGGPHSVVTTRYESLPNVHHNVTYTLDICKPLKKS
GKAKKSEECPNGTRVCAISRFLQGETDVVEQVVAIAGALENVGGSQFEYDATRLKTSDSNSDSQKEGLRLVLKGG
KHPLDGPVNERREQRAVVEFLCDPNRTGDEGEWEAEDEYDKNAKLRARADGDDDGDKNDGQDRSALEHQLKKDNA
ALLWESFEDEKDAKVLRLTWHTKYACEKREDGGDSDDKGDGSTSSHWGFFTWFVVIVFLGIAAYLIFGSWLNYNR
YGARGWDLVPHGDTIRDIPYLMKDWVRRVLNTVQGAGSRGGYSAV*
Coding >OphauB2|1520
ATGCGTGGGCCACAGCTGTCAGCGCTTGCTCTGTCGCTGCTGCTGACACGCAACCTGGGCGCGGCCATGTTGAGA
TGCGACAACGTACGGGTAGATGGACATAGTTTCGACCTGTCCAAGCTCGGAGGACCGCACTCAGTGGTGACGACG
CGGTATGAGTCGTTGCCAAATGTGCACCACAACGTGACGTATACGCTCGATATTTGCAAGCCACTCAAGAAGAGC
GGCAAGGCCAAAAAATCGGAGGAGTGCCCCAACGGGACTAGAGTGTGTGCCATTTCGCGATTTCTACAGGGAGAG
ACGGATGTGGTGGAGCAAGTAGTGGCGATAGCTGGCGCTCTAGAAAACGTGGGGGGATCACAGTTTGAATACGAC
GCAACGCGACTCAAGACGAGCGACTCCAACAGCGATTCCCAAAAGGAAGGCCTGCGGCTGGTGCTCAAGGGTGGC
AAGCACCCCCTCGACGGGCCTGTCAACGAGCGGCGTGAGCAGCGGGCCGTTGTCGAGTTTCTCTGCGACCCCAAT
AGGACAGGGGACGAGGGCGAGTGGGAGGCAGAAGATGAATACGACAAGAATGCCAAGCTGCGGGCTCGGGCCGAT
GGCGATGATGATGGCGACAAGAATGACGGCCAGGACAGGTCGGCATTGGAGCACCAGCTAAAAAAGGACAATGCA
GCGCTCCTTTGGGAGAGCTTTGAGGACGAAAAAGACGCCAAGGTGCTGCGGCTGACTTGGCATACAAAGTATGCT
TGCGAGAAGCGAGAAGACGGTGGCGACAGCGATGACAAGGGCGATGGGAGCACGAGCAGCCACTGGGGCTTCTTT
ACCTGGTTTGTCGTCATCGTCTTCCTCGGCATTGCTGCATACTTGATATTTGGCTCATGGCTCAACTACAATCGA
TACGGGGCTAGAGGCTGGGATCTTGTGCCCCACGGCGACACGATTCGGGACATACCATATCTGATGAAGGACTGG
GTCAGGCGAGTGCTCAACACTGTGCAAGGAGCGGGCAGTAGGGGAGGATATAGCGCTGTATAG
Transcript >OphauB2|1520
ATGCGTGGGCCACAGCTGTCAGCGCTTGCTCTGTCGCTGCTGCTGACACGCAACCTGGGCGCGGCCATGTTGAGA
TGCGACAACGTACGGGTAGATGGACATAGTTTCGACCTGTCCAAGCTCGGAGGACCGCACTCAGTGGTGACGACG
CGGTATGAGTCGTTGCCAAATGTGCACCACAACGTGACGTATACGCTCGATATTTGCAAGCCACTCAAGAAGAGC
GGCAAGGCCAAAAAATCGGAGGAGTGCCCCAACGGGACTAGAGTGTGTGCCATTTCGCGATTTCTACAGGGAGAG
ACGGATGTGGTGGAGCAAGTAGTGGCGATAGCTGGCGCTCTAGAAAACGTGGGGGGATCACAGTTTGAATACGAC
GCAACGCGACTCAAGACGAGCGACTCCAACAGCGATTCCCAAAAGGAAGGCCTGCGGCTGGTGCTCAAGGGTGGC
AAGCACCCCCTCGACGGGCCTGTCAACGAGCGGCGTGAGCAGCGGGCCGTTGTCGAGTTTCTCTGCGACCCCAAT
AGGACAGGGGACGAGGGCGAGTGGGAGGCAGAAGATGAATACGACAAGAATGCCAAGCTGCGGGCTCGGGCCGAT
GGCGATGATGATGGCGACAAGAATGACGGCCAGGACAGGTCGGCATTGGAGCACCAGCTAAAAAAGGACAATGCA
GCGCTCCTTTGGGAGAGCTTTGAGGACGAAAAAGACGCCAAGGTGCTGCGGCTGACTTGGCATACAAAGTATGCT
TGCGAGAAGCGAGAAGACGGTGGCGACAGCGATGACAAGGGCGATGGGAGCACGAGCAGCCACTGGGGCTTCTTT
ACCTGGTTTGTCGTCATCGTCTTCCTCGGCATTGCTGCATACTTGATATTTGGCTCATGGCTCAACTACAATCGA
TACGGGGCTAGAGGCTGGGATCTTGTGCCCCACGGCGACACGATTCGGGACATACCATATCTGATGAAGGACTGG
GTCAGGCGAGTGCTCAACACTGTGCAAGGAGCGGGCAGTAGGGGAGGATATAGCGCTGTATAG
Gene >OphauB2|1520
ATGCGTGGGCCACAGCTGTCAGCGCTTGCTCTGTCGCTGCTGCTGACACGCAACCTGGGCGCGGCCATGTTGAGA
TGCGACAACGTACGGGTAGATGGACATAGTTTCGACCTGTCCAAGCTCGGAGGACCGCACTCAGTGGTGACGACG
CGGTATGAGTCGTTGCCAAATGTGCACCACAACGTGACGTATACGCTCGATATTTGCAAGCCACTCAAGAAGAGC
GGCAAGGCCAAAAAATCGGAGGAGTGCCCCAACGGGACTAGAGGTGCGTGTGGTGCCGGATGGACAAGAGCATAC
AGAGCTAACCGGGACAGTGTGTGCCATTTCGCGATTTCTACAGGGAGAGACGGATGTGGTGGAGCAAGTAGTGGC
GATAGCTGGCGCTCTAGAAAACGTGGGGGGATCACAGTTTGAATACGACGCAACGCGACTCAAGACGAGCGACTC
CAACAGCGATTCCCAAAAGGAAGGCCTGCGGCTGGTGCTCAAGGGTGGCAAGCACCCCCTCGACGGGCCTGTCAA
CGAGCGGCGTGAGCAGCGGGCCGTTGTCGAGTTTCTCTGCGACCCCAATAGGACAGGGGACGAGGGCGAGTGGGA
GGCAGAAGATGAATACGACAAGAATGCCAAGCTGCGGGCTCGGGCCGATGGCGATGATGATGGCGACAAGAATGA
CGGCCAGGACAGGTCGGCATTGGAGCACCAGCTAAAAAAGGACAATGCAGCGCTCCTTTGGGAGAGCTTTGAGGA
CGAAAAAGACGCCAAGGTGCTGCGGCTGACTTGGCATACAAAGTATGCTTGCGAGAAGCGAGAAGACGGTGGCGA
CAGCGATGACAAGGGCGATGGGAGCACGAGCAGCCACTGGGGCTTCTTTACCTGGTTTGTCGTCATGTGAGTCTC
TCTGGGCCCTTGTAGGAATACGTGGACTGACACAAGCTACACAGCGTCTTCCTCGGCATTGCTGCATACTTGATA
TTTGGCTCATGGCTCAACTACAATCGATACGGGGCTAGAGGCTGGGATCTTGTGCCCCACGGCGACACGATTCGG
GACATACCATATCTGATGAAGGACTGGGTCAGGCGAGTGCTCAACACTGTGCAAGGAGCGGGCAGTAGGGGAGGA
TATAGCGCTGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail