Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1510
Gene name
LocationContig_14:175968..176550
Strand-
Gene length (bp)582
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08287 DASH_Spc19 Spc19 2.2E-37 9 162

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q50HP3|SPC19_SCHPO DASH complex subunit spc19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spc19 PE=1 SV=2 7 153 4.0E-17
sp|Q6BHU0|SPC19_DEBHA DASH complex subunit SPC19 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPC19 PE=3 SV=2 1 150 1.0E-12

GO

GO Term Description Terminal node
GO:0005876 spindle microtubule Yes
GO:0008608 attachment of spindle microtubules to kinetochore Yes
GO:0042729 DASH complex Yes
GO:0110165 cellular anatomical entity No
GO:0099080 supramolecular complex No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0022402 cell cycle process No
GO:0099513 polymeric cytoskeletal fiber No
GO:0008150 biological_process No
GO:0005874 microtubule No
GO:0099081 supramolecular polymer No
GO:0099512 supramolecular fiber No
GO:0140513 nuclear protein-containing complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1510
MAANSPSYADCVSALRSSLAHLDSSVETLGAGVSDFPRLVKTLKSVRHYELISQPTLAAAEASLRDEIGPYIALL
LSRAEAQTDHLDRRIEALKAKSELQRGRISRLDSAATSAAAPAPPPPRRVVSADAKLRARAKEALRYGVDRLELE
VLQTERELKRRLEG*
Coding >OphauB2|1510
ATGGCCGCCAATAGTCCATCATATGCCGACTGTGTCTCCGCGCTCCGCTCCTCGCTCGCCCACCTCGACTCGTCG
GTCGAGACGCTCGGCGCTGGCGTCTCCGACTTTCCACGCCTCGTCAAGACGCTCAAGTCTGTGCGCCACTACGAA
CTCATCTCCCAGCCCACCCTCGCCGCCGCCGAAGCTTCTCTCCGCGACGAAATCGGCCCCTACATTGCCCTGCTG
CTTTCCCGCGCAGAGGCCCAGACGGACCATCTCGACCGCCGCATCGAAGCCCTCAAGGCAAAGTCTGAGCTGCAG
CGCGGCCGCATCTCTCGCCTCGACTCCGCCGCTACCTCTGCTGCTGCCCCGGCTCCCCCACCTCCCCGCCGCGTC
GTCTCGGCCGACGCCAAGCTGCGTGCCCGTGCTAAGGAAGCTCTTCGCTATGGTGTCGATAGGCTGGAGCTCGAG
GTGCTGCAGACGGAGCGCGAGCTCAAGCGCCGCCTAGAAGGCTGA
Transcript >OphauB2|1510
ATGGCCGCCAATAGTCCATCATATGCCGACTGTGTCTCCGCGCTCCGCTCCTCGCTCGCCCACCTCGACTCGTCG
GTCGAGACGCTCGGCGCTGGCGTCTCCGACTTTCCACGCCTCGTCAAGACGCTCAAGTCTGTGCGCCACTACGAA
CTCATCTCCCAGCCCACCCTCGCCGCCGCCGAAGCTTCTCTCCGCGACGAAATCGGCCCCTACATTGCCCTGCTG
CTTTCCCGCGCAGAGGCCCAGACGGACCATCTCGACCGCCGCATCGAAGCCCTCAAGGCAAAGTCTGAGCTGCAG
CGCGGCCGCATCTCTCGCCTCGACTCCGCCGCTACCTCTGCTGCTGCCCCGGCTCCCCCACCTCCCCGCCGCGTC
GTCTCGGCCGACGCCAAGCTGCGTGCCCGTGCTAAGGAAGCTCTTCGCTATGGTGTCGATAGGCTGGAGCTCGAG
GTGCTGCAGACGGAGCGCGAGCTCAAGCGCCGCCTAGAAGGCTGA
Gene >OphauB2|1510
ATGGCCGCCAATAGTCCATCATATGCCGACTGTGTCTCCGCGCTCCGCTCCTCGCTCGCCCACCTCGACTCGTCG
GTCGAGACGCTCGGCGCTGGCGTCTCCGACTTTCCACGCCTCGTCAAGACGCTCAAGTCTGTGCGCGTACGTCTC
ACTTCCCAACCCCGGCTCCCCCCCCCGTTCTTCGTTCCTTGTGCTTTCCCCCCCCTCCAAGAGGCTCATCAAAAC
AAGCACTACGAACTCATCTCCCAGCCCACCCTCGCCGCCGCCGAAGCTTCTCTCCGCGACGAAATCGGCCCCTAC
ATTGCCCTGCTGCTTTCCCGCGCAGAGGCCCAGACGGACCATCTCGACCGCCGCATCGAAGCCCTCAAGGCAAAG
TCTGAGCTGCAGCGCGGCCGCATCTCTCGCCTCGACTCCGCCGCTACCTCTGCTGCTGCCCCGGCTCCCCCACCT
CCCCGCCGCGTCGTCTCGGCCGACGCCAAGCTGCGTGCCCGTGCTAAGGAAGCTCTTCGCTATGGTGTCGATAGG
CTGGAGCTCGAGGTGCTGCAGACGGAGCGCGAGCTCAAGCGCCGCCTAGAAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail