Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1508
Gene name
LocationContig_14:169061..170153
Strand-
Gene length (bp)1092
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 5.6E-22 8 237
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.2E-14 75 252

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 5 289 5.0E-16
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 5 289 2.0E-15
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 5 289 3.0E-14
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 5 289 4.0E-14
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 5 239 6.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 5 289 5.0E-16
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 5 289 2.0E-15
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 5 289 3.0E-14
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 5 289 4.0E-14
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 5 239 6.0E-13
sp|O08699|PGDH_RAT 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Rattus norvegicus GN=Hpgd PE=2 SV=2 5 288 1.0E-11
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 1 260 9.0E-11
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 5 283 2.0E-10
sp|Q9BPX1|DHB14_HUMAN 17-beta-hydroxysteroid dehydrogenase 14 OS=Homo sapiens GN=HSD17B14 PE=1 SV=1 58 235 2.0E-08
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 5 233 2.0E-08
sp|O42866|FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 99 276 3.0E-08
sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 5 282 4.0E-08
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 5 233 5.0E-08
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 10 265 2.0E-07
sp|Q9MYP6|DHB14_BOVIN 17-beta-hydroxysteroid dehydrogenase 14 OS=Bos taurus GN=HSD17B14 PE=2 SV=1 1 276 4.0E-07
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 3 233 7.0E-07
sp|P87017|AFLH_ASPPA 5'-hydroxyaverantin dehydrogenase OS=Aspergillus parasiticus GN=adhA PE=1 SV=2 4 240 7.0E-07
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 1 277 3.0E-06
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 1 277 3.0E-06
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 1 277 3.0E-06
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 3 235 4.0E-06
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 1 246 4.0E-06
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 8 237 6.0E-06
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 8 237 6.0E-06
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 5 234 7.0E-06
sp|Q7FAE1|MOMAS_ORYSJ Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1 7 231 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1508
MASSVNGKYALVTGAGSGNNLEFTKLLLENGCSVMMADLKLNAEAVALLDTYAPHAGEDTNGGRTEINGHRRPTA
HFHKTDVTSWPQLSALWEATLAAFPSINIVVPGAGVFEPPSVSFWQAPKSETNPDSVSRDAADSDPGHYRLIDVN
LVAPIRLSQLAIGYWTQKKDRTPGDANLVLFGSIAARIAALATPLYIASKHAIVAFARSLGALRDTVGIRVGCVA
PGPVATAIFEGFEKAAEDAEMIPIHQVADAMMQLVVNDAYGDGTILQVTPGKTYVVPLYNAPPIGEADLKMPGLG
AINDQVIHNLRTKGLQV*
Coding >OphauB2|1508
ATGGCATCCTCAGTAAATGGAAAATATGCCCTCGTCACCGGCGCTGGGTCAGGTAATAACCTCGAGTTCACCAAG
CTCTTGCTTGAAAACGGCTGTTCTGTCATGATGGCCGACCTCAAGCTCAATGCCGAGGCCGTTGCACTACTCGAT
ACCTACGCACCGCACGCTGGCGAGGATACAAATGGGGGTCGCACTGAAATCAATGGCCATAGACGCCCTACGGCG
CATTTCCACAAGACCGATGTGACGTCATGGCCTCAGCTCTCGGCTCTATGGGAGGCAACGCTGGCCGCTTTCCCC
TCCATCAACATTGTCGTTCCTGGAGCAGGAGTATTCGAACCACCCAGTGTCAGCTTTTGGCAAGCCCCCAAATCA
GAGACAAATCCAGACTCCGTGTCGCGGGATGCCGCAGACAGTGACCCAGGCCATTACCGTCTTATTGACGTCAAT
CTCGTCGCTCCCATCCGGCTGAGCCAGCTGGCCATTGGATATTGGACGCAGAAAAAGGATCGCACGCCGGGCGAT
GCCAATCTGGTCTTGTTTGGTAGCATTGCCGCCCGCATCGCAGCCCTTGCAACACCACTATACATTGCCTCCAAG
CATGCCATAGTTGCATTTGCAAGGTCACTTGGTGCCTTGCGTGATACTGTGGGCATTCGCGTCGGCTGCGTGGCC
CCGGGCCCAGTCGCAACCGCAATCTTTGAGGGCTTTGAAAAGGCAGCAGAGGATGCCGAAATGATCCCTATCCAC
CAAGTGGCAGACGCCATGATGCAGCTAGTCGTCAATGACGCGTACGGCGACGGCACCATCCTTCAGGTAACTCCA
GGCAAGACATATGTCGTTCCGCTATACAATGCACCTCCAATAGGTGAAGCAGATCTCAAAATGCCCGGCTTGGGG
GCCATAAACGACCAGGTCATCCACAATCTTCGCACCAAAGGTCTGCAAGTGTAG
Transcript >OphauB2|1508
ATGGCATCCTCAGTAAATGGAAAATATGCCCTCGTCACCGGCGCTGGGTCAGGTAATAACCTCGAGTTCACCAAG
CTCTTGCTTGAAAACGGCTGTTCTGTCATGATGGCCGACCTCAAGCTCAATGCCGAGGCCGTTGCACTACTCGAT
ACCTACGCACCGCACGCTGGCGAGGATACAAATGGGGGTCGCACTGAAATCAATGGCCATAGACGCCCTACGGCG
CATTTCCACAAGACCGATGTGACGTCATGGCCTCAGCTCTCGGCTCTATGGGAGGCAACGCTGGCCGCTTTCCCC
TCCATCAACATTGTCGTTCCTGGAGCAGGAGTATTCGAACCACCCAGTGTCAGCTTTTGGCAAGCCCCCAAATCA
GAGACAAATCCAGACTCCGTGTCGCGGGATGCCGCAGACAGTGACCCAGGCCATTACCGTCTTATTGACGTCAAT
CTCGTCGCTCCCATCCGGCTGAGCCAGCTGGCCATTGGATATTGGACGCAGAAAAAGGATCGCACGCCGGGCGAT
GCCAATCTGGTCTTGTTTGGTAGCATTGCCGCCCGCATCGCAGCCCTTGCAACACCACTATACATTGCCTCCAAG
CATGCCATAGTTGCATTTGCAAGGTCACTTGGTGCCTTGCGTGATACTGTGGGCATTCGCGTCGGCTGCGTGGCC
CCGGGCCCAGTCGCAACCGCAATCTTTGAGGGCTTTGAAAAGGCAGCAGAGGATGCCGAAATGATCCCTATCCAC
CAAGTGGCAGACGCCATGATGCAGCTAGTCGTCAATGACGCGTACGGCGACGGCACCATCCTTCAGGTAACTCCA
GGCAAGACATATGTCGTTCCGCTATACAATGCACCTCCAATAGGTGAAGCAGATCTCAAAATGCCCGGCTTGGGG
GCCATAAACGACCAGGTCATCCACAATCTTCGCACCAAAGGTCTGCAAGTGTAG
Gene >OphauB2|1508
ATGGCATCCTCAGTAAATGGAAAATATGCCCTCGTCACCGGCGCTGGGTCAGGTAGCTCTCTCTATTCAACAACG
GAAAAGGTCTCGTCATGGATTATTGACAAAGTCCATTCTTCTCGTTAGGTAATAACCTCGAGTTCACCAAGCTCT
TGCTTGAAAACGGCTGTTCTGTCATGATGGCCGACCTCAAGCTCAATGCCGAGGCCGTTGCACTACTCGATACCT
ACGCACCGCACGCTGGCGAGGATACAAATGGGGGTCGCACTGAAATCAATGGCCATAGACGCCCTACGGCGCATT
TCCACAAGACCGATGTGACGTCATGGCCTCAGCTCTCGGCTCTATGGGAGGCAACGCTGGCCGCTTTCCCCTCCA
TCAACATTGTCGTTCCTGGAGCAGGAGTATTCGAACCACCCAGTGTCAGCTTTTGGCAAGCCCCCAAATCAGAGA
CAAATCCAGACTCCGTGTCGCGGGATGCCGCAGACAGTGACCCAGGCCATTACCGTCTTATTGACGTCAATCTCG
TCGCTCCCATCCGGCTGAGCCAGCTGGCCATTGGATATTGGACGCAGAAAAAGGATCGCACGCCGGGCGATGCCA
ATCTGGTCTTGTTTGGTAGCATTGCCGCCCGCATCGCAGCCCTTGCAACACCACTATACATTGCCTCCAAGCATG
CCATAGTTGCATTTGCAAGGTCACTTGGTGCCTTGCGTGATACTGTGGGCATTCGCGTCGGCTGCGTGGCCCCGG
GCCCAGTCGCAGTAAGATGATGACTTGAATACCGAGCAAACAATGCTCATGGGCGCTGACATTTCGACTCGTAAC
CAGACCGCAATCTTTGAGGGCTTTGAAAAGGCAGCAGAGGATGCCGAAATGATCCCTATCCACCAAGTGGCAGAC
GCCATGATGCAGCTAGTCGTCAATGACGCGTACGGCGACGGCACCATCCTTCAGGTAACTCCAGGCAAGACATAT
GTCGTTCCGCTATACAATGCACCTCCAATAGGTGAAGCAGATCTCAAAATGCCCGGCTTGGGGGCCATAAACGAC
CAGGTCATCCACAATCTTCGCACCAAAGGTCTGCAAGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail