Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1506
Gene name
LocationContig_14:165709..167451
Strand-
Gene length (bp)1742
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 6.7E-91 17 415

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT6 PE=1 SV=1 18 402 4.0E-93
sp|O74327|AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt5 PE=3 SV=1 14 494 5.0E-91
sp|P38176|AVT5_YEAST Vacuolar amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT5 PE=3 SV=2 18 402 6.0E-87
sp|P40501|AVT7_YEAST Vacuolar amino acid transporter 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT7 PE=1 SV=1 18 418 3.0E-71
sp|Q6JWR2|S38A7_RAT Putative sodium-coupled neutral amino acid transporter 7 OS=Rattus norvegicus GN=Slc38a7 PE=2 SV=1 5 323 7.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40074|AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT6 PE=1 SV=1 18 402 4.0E-93
sp|O74327|AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt5 PE=3 SV=1 14 494 5.0E-91
sp|P38176|AVT5_YEAST Vacuolar amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT5 PE=3 SV=2 18 402 6.0E-87
sp|P40501|AVT7_YEAST Vacuolar amino acid transporter 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT7 PE=1 SV=1 18 418 3.0E-71
sp|Q6JWR2|S38A7_RAT Putative sodium-coupled neutral amino acid transporter 7 OS=Rattus norvegicus GN=Slc38a7 PE=2 SV=1 5 323 7.0E-26
sp|Q8BWH0|S38A7_MOUSE Putative sodium-coupled neutral amino acid transporter 7 OS=Mus musculus GN=Slc38a7 PE=1 SV=1 16 306 7.0E-25
sp|Q5SPB1|S38A2_DANRE Sodium-coupled neutral amino acid transporter 2 OS=Danio rerio GN=slc38a2 PE=3 SV=1 16 408 2.0E-24
sp|Q5R9F5|S38A7_PONAB Putative sodium-coupled neutral amino acid transporter 7 OS=Pongo abelii GN=SLC38A7 PE=2 SV=1 16 306 3.0E-24
sp|Q9NVC3|S38A7_HUMAN Putative sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens GN=SLC38A7 PE=1 SV=1 16 306 4.0E-24
sp|A7E3U5|S38A7_BOVIN Putative sodium-coupled neutral amino acid transporter 7 OS=Bos taurus GN=SLC38A7 PE=2 SV=1 23 313 4.0E-23
sp|Q6DEL1|S38A7_DANRE Putative sodium-coupled neutral amino acid transporter 7 OS=Danio rerio GN=slc38a7 PE=2 SV=1 11 406 1.0E-22
sp|Q28HE5|S38A6_XENTR Probable sodium-coupled neutral amino acid transporter 6 OS=Xenopus tropicalis GN=slc38a6 PE=2 SV=1 16 413 3.0E-22
sp|Q5XH90|S38A2_XENTR Sodium-coupled neutral amino acid transporter 2 OS=Xenopus tropicalis GN=slc38a2 PE=2 SV=1 6 408 1.0E-20
sp|Q96QD8|S38A2_HUMAN Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens GN=SLC38A2 PE=1 SV=2 2 406 1.0E-19
sp|A1YG32|S38A2_PANPA Sodium-coupled neutral amino acid transporter 2 OS=Pan paniscus GN=SLC38A2 PE=3 SV=1 2 406 1.0E-19
sp|Q8IZM9|S38A6_HUMAN Probable sodium-coupled neutral amino acid transporter 6 OS=Homo sapiens GN=SLC38A6 PE=1 SV=2 23 413 3.0E-19
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 16 402 3.0E-19
sp|Q5F468|S38A2_CHICK Sodium-coupled neutral amino acid transporter 2 OS=Gallus gallus GN=SLC38A2 PE=2 SV=2 2 414 4.0E-19
sp|Q5R443|S38A1_PONAB Sodium-coupled neutral amino acid transporter 1 OS=Pongo abelii GN=SLC38A1 PE=2 SV=1 6 406 4.0E-19
sp|Q9H2H9|S38A1_HUMAN Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens GN=SLC38A1 PE=1 SV=1 6 406 8.0E-19
sp|D3Z813|S38AB_RAT Putative sodium-coupled neutral amino acid transporter 11 OS=Rattus norvegicus GN=Slc38a11 PE=2 SV=1 14 414 9.0E-19
sp|Q6WWW3|S38A6_RAT Probable sodium-coupled neutral amino acid transporter 6 OS=Rattus norvegicus GN=Slc38a6 PE=2 SV=1 2 413 1.0E-18
sp|E9PT23|S38AA_RAT Putative sodium-coupled neutral amino acid transporter 10 OS=Rattus norvegicus GN=Slc38a10 PE=2 SV=2 24 401 2.0E-18
sp|Q9JHE5|S38A2_RAT Sodium-coupled neutral amino acid transporter 2 OS=Rattus norvegicus GN=Slc38a2 PE=1 SV=1 2 406 4.0E-18
sp|Q5I012|S38AA_MOUSE Putative sodium-coupled neutral amino acid transporter 10 OS=Mus musculus GN=Slc38a10 PE=1 SV=2 24 401 4.0E-18
sp|G3UVW3|S38A6_MOUSE Probable sodium-coupled neutral amino acid transporter 6 OS=Mus musculus GN=Slc38a6 PE=2 SV=1 2 413 5.0E-18
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 1 407 7.0E-18
sp|Q9EQ25|S38A4_RAT Sodium-coupled neutral amino acid transporter 4 OS=Rattus norvegicus GN=Slc38a4 PE=1 SV=1 11 414 7.0E-18
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 2 406 8.0E-18
sp|Q5RC98|S38AA_PONAB Putative sodium-coupled neutral amino acid transporter 10 OS=Pongo abelii GN=SLC38A10 PE=2 SV=1 24 402 9.0E-18
sp|Q6DFE7|S38A7_XENLA Putative sodium-coupled neutral amino acid transporter 7 OS=Xenopus laevis GN=slc38a7 PE=2 SV=1 16 412 1.0E-17
sp|Q9HBR0|S38AA_HUMAN Putative sodium-coupled neutral amino acid transporter 10 OS=Homo sapiens GN=SLC38A10 PE=1 SV=2 24 402 2.0E-17
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 16 406 4.0E-17
sp|Q5E9S9|S38A5_BOVIN Sodium-coupled neutral amino acid transporter 5 OS=Bos taurus GN=SLC38A5 PE=2 SV=1 6 402 9.0E-17
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 1 402 2.0E-16
sp|Q3USY0|S38AB_MOUSE Putative sodium-coupled neutral amino acid transporter 11 OS=Mus musculus GN=Slc38a11 PE=2 SV=2 2 414 7.0E-16
sp|A2VE31|S38A2_BOVIN Sodium-coupled neutral amino acid transporter 2 OS=Bos taurus GN=SLC38A2 PE=2 SV=1 2 448 1.0E-15
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 18 404 1.0E-15
sp|Q3U1J0|S38A5_MOUSE Sodium-coupled neutral amino acid transporter 5 OS=Mus musculus GN=Slc38a5 PE=1 SV=1 4 402 9.0E-15
sp|A2VCW5|S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus GN=Slc38a5 PE=1 SV=1 3 406 9.0E-15
sp|Q8WUX1|S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens GN=SLC38A5 PE=1 SV=1 16 402 1.0E-14
sp|Q6PCF9|S38AA_XENLA Putative sodium-coupled neutral amino acid transporter 10 OS=Xenopus laevis GN=slc38a10 PE=2 SV=1 24 402 3.0E-14
sp|Q8CFE6|S38A2_MOUSE Sodium-coupled neutral amino acid transporter 2 OS=Mus musculus GN=Slc38a2 PE=1 SV=1 2 406 8.0E-14
sp|Q5EA97|S38AB_BOVIN Putative sodium-coupled neutral amino acid transporter 11 OS=Bos taurus GN=SLC38A11 PE=2 SV=1 5 414 2.0E-13
sp|Q969I6|S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens GN=SLC38A4 PE=1 SV=1 207 407 8.0E-12
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 207 407 9.0E-12
sp|A8KBL5|S38AB_DANRE Putative sodium-coupled neutral amino acid transporter 11 OS=Danio rerio GN=slc38a11 PE=2 SV=2 2 414 1.0E-11
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 17 395 3.0E-10
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 207 414 7.0E-10
sp|A6NNN8|S38A8_HUMAN Putative sodium-coupled neutral amino acid transporter 8 OS=Homo sapiens GN=SLC38A8 PE=1 SV=1 7 397 1.0E-09
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 11 279 2.0E-09
sp|Q5HZH7|S38A8_MOUSE Putative sodium-coupled neutral amino acid transporter 8 OS=Mus musculus GN=Slc38a8 PE=2 SV=1 2 397 4.0E-09
sp|Q28I47|S38A8_XENTR Putative sodium-coupled neutral amino acid transporter 8 OS=Xenopus tropicalis GN=slc38a8 PE=2 SV=1 10 279 7.0E-09
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 11 397 7.0E-09
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 13 416 7.0E-09
sp|P34579|UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans GN=unc-47 PE=1 SV=2 4 404 1.0E-08
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 19 282 2.0E-08
sp|Q8HXI3|S38AB_MACFA Putative sodium-coupled neutral amino acid transporter 11 OS=Macaca fascicularis GN=SLC38A11 PE=2 SV=1 5 414 2.0E-07
sp|Q08AI6|S38AB_HUMAN Putative sodium-coupled neutral amino acid transporter 11 OS=Homo sapiens GN=SLC38A11 PE=2 SV=1 43 415 3.0E-07
sp|Q969I6|S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens GN=SLC38A4 PE=1 SV=1 1 184 3.0E-06
sp|Q8R1S9|S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus GN=Slc38a4 PE=1 SV=1 1 184 5.0E-06
sp|Q5RE87|S38A4_PONAB Sodium-coupled neutral amino acid transporter 4 OS=Pongo abelii GN=SLC38A4 PE=2 SV=1 1 184 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 46 68 22
3 95 117 22
4 137 159 22
5 166 188 22
6 238 260 22
7 281 303 22
8 354 373 19
9 378 400 22
10 475 497 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1506
MSRTRRRGAKDAGHGGQASILSSIVNLLNTIVGAGTLAMPSVLSHMGIALGVVLILWSGVTAAFGLYLQSRCARY
LDRGTSSFFALSQITYPTASVLFDLAIAVKCFGVGVSYMIIIGDLMPGVVLGFRSGAAAMPYLVDRHFWITAFML
LIIPLSFLRRLDSLKYTSLVALVSIGYLIVLVIYHFAVDPHADPRDIRVLHWEGAVQTLSALPVVVFAYTCHQNM
FSVINEIKDGSPAAMVGVVGASIGSAACIYVVVAITGYITFGNAIVGNIVSMYPTGVASTIGKAAIVILVLFSVP
LQVHPCRASLDAVLKWRLNRSSPHSGRPGSPPLNQATAARGDHGGGAPMSDTRFALLTTVILTLAYMTALSVSSL
DRVLAFVGSTGSTSISFILPGLFYYKISDPDSIHHQRLIKVDDDMEDVNSDVEDAGGMLAQSTSSIHSAAGAGSR
LQWRWRRKWRWDLEHLEHGLVRKLALSLAIYGIVVMAVCLIMNIFFAVAQ*
Coding >OphauB2|1506
ATGTCAAGAACGAGGCGTCGTGGCGCCAAGGATGCCGGCCACGGAGGCCAGGCCTCTATCCTCAGCAGCATCGTC
AACCTGCTCAACACGATCGTCGGTGCCGGCACGCTGGCCATGCCTTCAGTCCTCTCGCACATGGGCATCGCCCTC
GGCGTCGTTTTGATTCTCTGGTCGGGCGTCACGGCTGCCTTTGGTCTCTATCTGCAGTCGAGATGCGCCCGCTAC
CTCGATCGCGGCACCTCGTCATTCTTCGCCCTGTCGCAAATTACCTATCCAACCGCTTCTGTCCTCTTCGACCTG
GCCATTGCAGTCAAGTGCTTTGGTGTTGGAGTTTCATACATGATTATCATTGGCGACTTGATGCCCGGCGTCGTC
CTAGGCTTCAGAAGCGGCGCCGCCGCCATGCCCTATCTCGTCGACCGCCACTTCTGGATCACGGCATTCATGCTG
CTCATCATCCCCCTCAGCTTTCTACGCAGGCTCGACTCGTTAAAGTACACCAGTCTCGTTGCCCTCGTCTCTATT
GGCTACCTCATCGTCTTGGTCATTTATCACTTTGCTGTAGATCCACATGCCGATCCTCGAGACATTCGCGTCCTT
CATTGGGAAGGGGCAGTACAGACGCTAAGCGCCTTGCCTGTAGTCGTCTTTGCCTACACTTGCCATCAAAATATG
TTTTCCGTCATTAATGAAATTAAAGACGGCTCACCGGCAGCCATGGTGGGCGTTGTCGGTGCCAGCATTGGCTCA
GCGGCTTGCATCTACGTCGTCGTCGCCATTACCGGCTACATCACTTTTGGCAATGCCATTGTTGGCAATATCGTC
TCCATGTATCCAACGGGTGTCGCATCCACTATTGGAAAGGCTGCAATTGTCATTCTCGTCTTATTTTCCGTCCCG
CTGCAGGTCCATCCCTGCCGTGCCTCTCTCGATGCAGTCTTGAAGTGGCGTCTCAACAGATCCAGCCCTCACTCT
GGCCGTCCGGGCTCTCCGCCTCTCAATCAAGCTACTGCTGCGCGTGGCGACCACGGTGGCGGCGCCCCCATGTCT
GACACCCGATTTGCCCTTTTGACAACAGTCATCTTGACCCTTGCGTACATGACTGCCTTGTCAGTTAGCAGCCTT
GACCGCGTCTTGGCCTTTGTGGGCAGCACGGGCTCGACTTCCATCAGTTTTATTTTGCCCGGGCTATTCTATTAC
AAAATCAGCGACCCAGACAGCATTCACCACCAGCGCCTCATCAAAGTCGATGACGACATGGAAGACGTCAACTCG
GACGTTGAGGATGCTGGCGGCATGCTAGCACAGAGCACTTCGAGTATTCACAGCGCTGCGGGCGCAGGGTCCCGT
CTCCAGTGGCGTTGGCGCAGGAAATGGCGATGGGATCTCGAGCATCTGGAGCATGGGCTCGTACGAAAGCTTGCC
TTGTCCCTTGCCATCTACGGCATCGTCGTCATGGCAGTGTGTTTGATCATGAACATATTCTTTGCTGTTGCTCAG
TAG
Transcript >OphauB2|1506
ATGTCAAGAACGAGGCGTCGTGGCGCCAAGGATGCCGGCCACGGAGGCCAGGCCTCTATCCTCAGCAGCATCGTC
AACCTGCTCAACACGATCGTCGGTGCCGGCACGCTGGCCATGCCTTCAGTCCTCTCGCACATGGGCATCGCCCTC
GGCGTCGTTTTGATTCTCTGGTCGGGCGTCACGGCTGCCTTTGGTCTCTATCTGCAGTCGAGATGCGCCCGCTAC
CTCGATCGCGGCACCTCGTCATTCTTCGCCCTGTCGCAAATTACCTATCCAACCGCTTCTGTCCTCTTCGACCTG
GCCATTGCAGTCAAGTGCTTTGGTGTTGGAGTTTCATACATGATTATCATTGGCGACTTGATGCCCGGCGTCGTC
CTAGGCTTCAGAAGCGGCGCCGCCGCCATGCCCTATCTCGTCGACCGCCACTTCTGGATCACGGCATTCATGCTG
CTCATCATCCCCCTCAGCTTTCTACGCAGGCTCGACTCGTTAAAGTACACCAGTCTCGTTGCCCTCGTCTCTATT
GGCTACCTCATCGTCTTGGTCATTTATCACTTTGCTGTAGATCCACATGCCGATCCTCGAGACATTCGCGTCCTT
CATTGGGAAGGGGCAGTACAGACGCTAAGCGCCTTGCCTGTAGTCGTCTTTGCCTACACTTGCCATCAAAATATG
TTTTCCGTCATTAATGAAATTAAAGACGGCTCACCGGCAGCCATGGTGGGCGTTGTCGGTGCCAGCATTGGCTCA
GCGGCTTGCATCTACGTCGTCGTCGCCATTACCGGCTACATCACTTTTGGCAATGCCATTGTTGGCAATATCGTC
TCCATGTATCCAACGGGTGTCGCATCCACTATTGGAAAGGCTGCAATTGTCATTCTCGTCTTATTTTCCGTCCCG
CTGCAGGTCCATCCCTGCCGTGCCTCTCTCGATGCAGTCTTGAAGTGGCGTCTCAACAGATCCAGCCCTCACTCT
GGCCGTCCGGGCTCTCCGCCTCTCAATCAAGCTACTGCTGCGCGTGGCGACCACGGTGGCGGCGCCCCCATGTCT
GACACCCGATTTGCCCTTTTGACAACAGTCATCTTGACCCTTGCGTACATGACTGCCTTGTCAGTTAGCAGCCTT
GACCGCGTCTTGGCCTTTGTGGGCAGCACGGGCTCGACTTCCATCAGTTTTATTTTGCCCGGGCTATTCTATTAC
AAAATCAGCGACCCAGACAGCATTCACCACCAGCGCCTCATCAAAGTCGATGACGACATGGAAGACGTCAACTCG
GACGTTGAGGATGCTGGCGGCATGCTAGCACAGAGCACTTCGAGTATTCACAGCGCTGCGGGCGCAGGGTCCCGT
CTCCAGTGGCGTTGGCGCAGGAAATGGCGATGGGATCTCGAGCATCTGGAGCATGGGCTCGTACGAAAGCTTGCC
TTGTCCCTTGCCATCTACGGCATCGTCGTCATGGCAGTGTGTTTGATCATGAACATATTCTTTGCTGTTGCTCAG
TAG
Gene >OphauB2|1506
ATGTCAAGGTAACCAGGCGACACAGCTCTCGTGCCATGAGCATTGCTGACGCGCATCGCATCAAAGAACGAGGCG
TCGTGGCGCCAAGGATGCCGGCCACGGAGGCCAGGCCTCTATCCTCAGCAGCATCGTCAACCTGCTCAACACGAG
TCAGTCTGCTCCTTCAACGCCGCGCTCTGCTCCTCCATCTTTGCTGACTCGCTCTGGCTGCAGTCGTCGGTGCCG
GCACGCTGGCCATGCCTTCAGTCCTCTCGCACATGGGCATCGCCCTCGGCGTCGTTTTGATTCTCTGGTCGGGCG
TCACGGCTGCCTTTGGTCTCTATCTGCAGTCGAGATGCGCCCGCTACCTCGATCGCGGCACCTCGTCATTCTTCG
CCCTGTCGCAAATTACCTATCCAACCGCTTCTGTCCTCTTCGACCTGGCCATTGCAGTCAAGTGCTTTGGTGTTG
GAGTTTCATACATGATTATCATTGGCGACTTGATGCCCGGCGTCGTCCTAGGCTTCAGAAGCGGCGCCGCCGCCA
TGCCCTATCTCGTCGACCGCCACTTCTGGATCACGGCATTCATGCTGCTCATCATCCCCCTCAGCTTTCTACGCA
GGCTCGACTCGTTAAAGTACACCAGTCTCGTTGCCCTCGTCTCTATTGGCTACCTCATCGTCTTGGTCATTTATC
ACTTTGCTGTAGATCCACATGCCGATCCTCGAGACATTCGCGTCCTTCATTGGGAAGGGGCAGTACAGACGCTAA
GCGCCTTGCCTGTAGTCGTCTTTGCCTACACTTGCCATCAAAATGTTGGTCCAAAGTTGCAGCAGCATCGTATTA
AAGTGTGGCTAACGCGCTCATCAGATGTTTTCCGTCATTAATGAAATTAAAGACGGCTCACCGGCAGCCATGGTG
GGCGTTGTCGGTGCCAGCATTGGCTCAGCGGCTTGCATCTACGTCGTCGTCGCCATTACCGGCTACATCACTTTT
GGCAATGCCATTGTTGGCAATATCGTCTCCATGTGTAAGACAAGCCCAGCCATCTCCCAGCTTTGAGACTCAACT
CACACAGTCTCGTCATTGCAGATCCAACGGGTGTCGCATCCACTATTGGAAAGGCTGCAATTGTCATTCTCGTCT
TATTTTCCGTCCCGCTGCAGGTCCATCCCTGCCGTGCCTCTCTCGATGCAGTCTTGAAGTGGCGTCTCAACAGAT
CCAGCCCTCACTCTGGCCGTCCGGGCTCTCCGCCTCTCAATCAAGCTACTGCTGCGCGTGGCGACCACGGTGGCG
GCGCCCCCATGTCTGACACCCGATTTGCCCTTTTGACAACAGTCATCTTGACCCTTGCGTACATGACTGCCTTGT
CAGTTAGCAGCCTTGACCGCGTCTTGGCCTTTGTGGGCAGCACGGGCTCGACTTCCATCAGTTTTATTTTGCCCG
GGCTATTCTATTACAAAATCAGCGACCCAGACAGCATTCACCACCAGCGCCTCATCAAAGTCGATGACGACATGG
AAGACGTCAACTCGGACGTTGAGGATGCTGGCGGCATGCTAGCACAGAGCACTTCGAGTATTCACAGCGCTGCGG
GCGCAGGGTCCCGTCTCCAGTGGCGTTGGCGCAGGAAATGGCGATGGGATCTCGAGCATCTGGAGCATGGGCTCG
TACGAAAGCTTGCCTTGTCCCTTGCCATCTACGGCATCGTCGTCATGGCAGTGTGTTTGATCATGAACATATTCT
TTGCTGTTGCTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail