Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1500
Gene name
LocationContig_14:147753..149070
Strand-
Gene length (bp)1317
Transcript length (bp)1221
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16881 LIAS_N N-terminal domain of lipoyl synthase of Radical_SAM family 1.8E-14 51 124
PF04055 Radical_SAM Radical SAM superfamily 2.3E-14 148 308

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z527|LIPA_NECH7 Lipoyl synthase, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_66689 PE=3 SV=1 5 406 0.0E+00
sp|B2AT43|LIPA_PODAN Lipoyl synthase, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_14620 PE=3 SV=1 1 401 0.0E+00
sp|Q7SF84|LIPA_NEUCR Lipoyl synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00565 PE=3 SV=1 1 401 0.0E+00
sp|D1Z4I6|LIPA_SORMK Lipoyl synthase, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_01256 PE=3 SV=1 10 401 0.0E+00
sp|A7EV21|LIPA_SCLS1 Lipoyl synthase, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_09179 PE=3 SV=1 20 384 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7Z527|LIPA_NECH7 Lipoyl synthase, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_66689 PE=3 SV=1 5 406 0.0E+00
sp|B2AT43|LIPA_PODAN Lipoyl synthase, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_14620 PE=3 SV=1 1 401 0.0E+00
sp|Q7SF84|LIPA_NEUCR Lipoyl synthase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU00565 PE=3 SV=1 1 401 0.0E+00
sp|D1Z4I6|LIPA_SORMK Lipoyl synthase, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_01256 PE=3 SV=1 10 401 0.0E+00
sp|A7EV21|LIPA_SCLS1 Lipoyl synthase, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_09179 PE=3 SV=1 20 384 0.0E+00
sp|B6HFQ1|LIPA_PENRW Lipoyl synthase, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc20g03200 PE=3 SV=1 39 405 0.0E+00
sp|Q2U4H2|LIPA_ASPOR Lipoyl synthase, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090020000344 PE=3 SV=1 39 397 0.0E+00
sp|B8NUL8|LIPA_ASPFN Lipoyl synthase, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_100710 PE=3 SV=1 39 397 0.0E+00
sp|A1CJC4|LIPA_ASPCL Lipoyl synthase, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_034510 PE=3 SV=1 28 382 0.0E+00
sp|Q0V6U4|LIPA_PHANO Lipoyl synthase, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_00270 PE=3 SV=2 51 382 0.0E+00
sp|Q5AQE4|LIPA_EMENI Lipoyl synthase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN9486 PE=3 SV=1 51 382 0.0E+00
sp|B2WBE8|LIPA_PYRTR Lipoyl synthase, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_06961 PE=3 SV=1 12 398 0.0E+00
sp|Q4WWP1|LIPA_ASPFU Lipoyl synthase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G06560 PE=3 SV=1 44 382 0.0E+00
sp|B0XYY2|LIPA_ASPFC Lipoyl synthase, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_042490 PE=3 SV=1 44 382 0.0E+00
sp|A1D855|LIPA_NEOFI Lipoyl synthase, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_070700 PE=3 SV=1 44 382 0.0E+00
sp|C5JVC1|LIPA_AJEDS Lipoyl synthase, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_06713 PE=3 SV=1 39 395 0.0E+00
sp|C5GPL2|LIPA_AJEDR Lipoyl synthase, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_05907 PE=3 SV=1 39 395 0.0E+00
sp|C5FZJ2|LIPA_ARTOC Lipoyl synthase, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_08114 PE=3 SV=1 7 386 0.0E+00
sp|C0NXP6|LIPA_AJECG Lipoyl synthase, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_07690 PE=3 SV=1 2 386 2.0E-180
sp|C1H594|LIPA_PARBA Lipoyl synthase, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_05935 PE=3 SV=1 9 385 4.0E-180
sp|C6HLY2|LIPA_AJECH Lipoyl synthase, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=HCDG_07601 PE=3 SV=1 2 384 4.0E-179
sp|C5PIN8|LIPA_COCP7 Lipoyl synthase, mitochondrial OS=Coccidioides posadasii (strain C735) GN=CPC735_057610 PE=3 SV=1 23 385 5.0E-179
sp|B6QSZ4|LIPA_TALMQ Lipoyl synthase, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_003450 PE=3 SV=1 7 387 7.0E-178
sp|C4JE77|LIPA_UNCRE Lipoyl synthase, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_00501 PE=3 SV=1 21 398 4.0E-177
sp|C1GFM3|LIPA_PARBD Lipoyl synthase, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_06059 PE=3 SV=1 31 382 3.0E-175
sp|C0SDG9|LIPA_PARBP Lipoyl synthase, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_05724 PE=3 SV=1 44 382 7.0E-175
sp|A5ABM5|LIPA_ASPNC Lipoyl synthase, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An11g09760 PE=3 SV=1 36 382 8.0E-169
sp|B8MLU5|LIPA_TALSN Lipoyl synthase, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_101110 PE=3 SV=1 36 387 3.0E-167
sp|A8N1T1|LIPA_COPC7 Lipoyl synthase, mitochondrial OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_03624 PE=3 SV=1 86 399 2.0E-159
sp|Q6C6C6|LIPA_YARLI Lipoyl synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E10571g PE=3 SV=1 86 388 6.0E-159
sp|B6K4J2|LIPA_SCHJY Lipoyl synthase, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_03553 PE=3 SV=1 52 389 2.0E-157
sp|B0CQH8|LIPA_LACBS Lipoyl synthase, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_181332 PE=3 SV=1 86 382 2.0E-155
sp|C5DY71|LIPA_ZYGRC Lipoyl synthase, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0F10758g PE=3 SV=1 42 382 6.0E-153
sp|O13642|LIPA_SCHPO Lipoyl synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lip5 PE=3 SV=2 51 384 7.0E-153
sp|C5DGZ5|LIPA_LACTC Lipoyl synthase, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KLTH0D09548g PE=3 SV=1 28 384 4.0E-151
sp|A5DGI1|LIPA_PICGU Lipoyl synthase, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_02382 PE=3 SV=2 22 400 4.0E-150
sp|P32875|LIPA_YEAST Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LIP5 PE=1 SV=1 86 382 7.0E-150
sp|C8ZGV5|LIPA_YEAS8 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=LIP5 PE=3 SV=1 86 382 7.0E-150
sp|A6ZP42|LIPA_YEAS7 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=LIP5 PE=3 SV=1 86 382 7.0E-150
sp|B5VS81|LIPA_YEAS6 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=LIP5 PE=3 SV=1 86 382 7.0E-150
sp|C7GWI3|LIPA_YEAS2 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=LIP5 PE=3 SV=1 86 382 7.0E-150
sp|B3LJM6|LIPA_YEAS1 Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=LIP5 PE=3 SV=1 86 382 7.0E-150
sp|A3GGJ5|LIPA_PICST Lipoyl synthase, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_86231 PE=3 SV=2 21 391 1.0E-149
sp|C5M276|LIPA_CANTT Lipoyl synthase, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CTRG_00165 PE=3 SV=1 37 405 2.0E-149
sp|Q6FPY0|LIPA_CANGA Lipoyl synthase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0I10923g PE=3 SV=1 86 382 9.0E-149
sp|C4QYF2|LIPA_PICPG Lipoyl synthase, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr1-4_0425 PE=3 SV=1 51 382 9.0E-149
sp|Q6CLS2|LIPA_KLULA Lipoyl synthase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F00836g PE=3 SV=1 84 383 4.0E-148
sp|P0CH68|LIPA_CANAW Lipoyl synthase, mitochondrial OS=Candida albicans (strain WO-1) GN=LAB5 PE=3 SV=1 51 391 3.0E-146
sp|P0CH67|LIPA_CANAL Lipoyl synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAB5 PE=3 SV=1 51 391 3.0E-146
sp|B5RUV1|LIPA_DEBHA Lipoyl synthase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G18854g PE=3 SV=1 39 391 3.0E-146
sp|Q74ZH6|LIPA_ASHGO Lipoyl synthase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGR231C PE=3 SV=1 86 382 1.0E-145
sp|B9WFS9|LIPA_CANDC Lipoyl synthase, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_42180 PE=3 SV=1 51 391 2.0E-145
sp|P0CO58|LIPA_CRYNJ Lipoyl synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNL04340 PE=3 SV=1 22 382 4.0E-145
sp|P0CO59|LIPA_CRYNB Lipoyl synthase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBI2500 PE=3 SV=1 22 382 4.0E-145
sp|A5E450|LIPA_LODEL Lipoyl synthase, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_04389 PE=3 SV=1 39 391 9.0E-144
sp|C4YA37|LIPA_CLAL4 Lipoyl synthase, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=CLUG_04975 PE=3 SV=1 37 391 6.0E-142
sp|Q6PHG4|LIAS_DANRE Lipoyl synthase, mitochondrial OS=Danio rerio GN=lias PE=2 SV=1 86 389 3.0E-139
sp|Q5BIP7|LIAS_BOVIN Lipoyl synthase, mitochondrial OS=Bos taurus GN=LIAS PE=2 SV=1 86 382 2.0E-138
sp|Q16W22|LIAS_AEDAE Lipoyl synthase, mitochondrial OS=Aedes aegypti GN=AAEL009368 PE=3 SV=1 86 385 2.0E-138
sp|B4IAA7|LIAS_DROSE Lipoyl synthase, mitochondrial OS=Drosophila sechellia GN=Las PE=3 SV=1 86 387 2.0E-137
sp|Q7JQW6|LIAS_DROME Lipoyl synthase, mitochondrial OS=Drosophila melanogaster GN=Las PE=1 SV=2 86 387 3.0E-137
sp|B4PF83|LIAS2_DROYA Lipoyl synthase 2, mitochondrial OS=Drosophila yakuba GN=Las2 PE=3 SV=1 86 387 5.0E-137
sp|B4IUG3|LIAS1_DROYA Lipoyl synthase 1, mitochondrial OS=Drosophila yakuba GN=Las1 PE=3 SV=1 86 387 5.0E-137
sp|B0WAU6|LIAS_CULQU Lipoyl synthase, mitochondrial OS=Culex quinquefasciatus GN=CPIJ004250 PE=3 SV=1 52 382 6.0E-137
sp|B7FRU7|LIPA1_PHATC Lipoyl synthase 1, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_18029 PE=3 SV=1 50 382 3.0E-136
sp|Q99M04|LIAS_MOUSE Lipoyl synthase, mitochondrial OS=Mus musculus GN=Lias PE=1 SV=1 86 382 7.0E-136
sp|Q2LYK1|LIAS_DROPS Lipoyl synthase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=Las PE=3 SV=1 86 392 7.0E-136
sp|B3NIL9|LIAS_DROER Lipoyl synthase, mitochondrial OS=Drosophila erecta GN=Las PE=3 SV=1 86 387 1.0E-135
sp|O43766|LIAS_HUMAN Lipoyl synthase, mitochondrial OS=Homo sapiens GN=LIAS PE=1 SV=3 86 382 1.0E-135
sp|B4KYY0|LIAS_DROMO Lipoyl synthase, mitochondrial OS=Drosophila mojavensis GN=Las PE=3 SV=1 86 382 3.0E-135
sp|Q6GQ48|LIAS_XENLA Lipoyl synthase, mitochondrial OS=Xenopus laevis GN=lias PE=2 SV=1 86 382 5.0E-135
sp|B4J3F3|LIAS_DROGR Lipoyl synthase, mitochondrial OS=Drosophila grimshawi GN=Las PE=3 SV=1 86 382 6.0E-134
sp|B3M996|LIAS_DROAN Lipoyl synthase, mitochondrial OS=Drosophila ananassae GN=Las PE=3 SV=1 86 382 8.0E-134
sp|C3Y3G4|LIAS_BRAFL Lipoyl synthase, mitochondrial OS=Branchiostoma floridae GN=BRAFLDRAFT_125969 PE=3 SV=1 78 385 2.0E-133
sp|B4MXR6|LIAS_DROWI Lipoyl synthase, mitochondrial OS=Drosophila willistoni GN=Las PE=3 SV=1 86 391 5.0E-133
sp|Q5XIH4|LIAS_RAT Lipoyl synthase, mitochondrial OS=Rattus norvegicus GN=Lias PE=2 SV=1 86 382 6.0E-133
sp|Q21452|LIAS_CAEEL Lipoyl synthase, mitochondrial OS=Caenorhabditis elegans GN=M01F1.3 PE=3 SV=1 39 382 2.0E-131
sp|C4PZQ3|LIAS_SCHMA Lipoyl synthase, mitochondrial OS=Schistosoma mansoni GN=Smp_010100 PE=3 SV=1 31 388 2.0E-128
sp|A8PF69|LIAS_BRUMA Lipoyl synthase, mitochondrial OS=Brugia malayi GN=Bm1_23910 PE=3 SV=1 51 382 2.0E-126
sp|A4RZ86|LIAS_OSTLU Lipoyl synthase, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=LIP1 PE=3 SV=1 77 389 9.0E-125
sp|A8JGF7|LIAS_CHLRE Lipoyl synthase, mitochondrial OS=Chlamydomonas reinhardtii GN=LIP1 PE=3 SV=1 99 380 2.0E-124
sp|Q8IDQ0|LIPA_PLAF7 Lipoyl synthase, apicoplast OS=Plasmodium falciparum (isolate 3D7) GN=lipA PE=2 SV=1 70 386 4.0E-122
sp|B9RX57|LISC_RICCO Lipoyl synthase, chloroplastic OS=Ricinus communis GN=LIP1P PE=3 SV=1 75 390 6.0E-121
sp|Q7RBD6|LIPA_PLAYO Lipoyl synthase, apicoplast OS=Plasmodium yoelii yoelii GN=lipA PE=3 SV=1 58 387 7.0E-121
sp|B3SBB5|LIAS_TRIAD Lipoyl synthase, mitochondrial OS=Trichoplax adhaerens GN=TRIADDRAFT_38449 PE=3 SV=1 87 382 4.0E-120
sp|A5CB81|LIAS_VITVI Lipoyl synthase, mitochondrial OS=Vitis vinifera GN=LIP1 PE=3 SV=1 36 379 1.0E-119
sp|D0A0G6|LIPA_TRYB9 Lipoyl synthase, mitochondrial OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=TbgDal_X18270 PE=3 SV=1 73 382 2.0E-119
sp|Q388A7|LIPA_TRYB2 Lipoyl synthase, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.61.1530 PE=3 SV=1 73 382 2.0E-119
sp|B8B016|LISC2_ORYSI Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. indica GN=LIP1P-2 PE=3 SV=1 76 385 3.0E-119
sp|Q6L534|LISC2_ORYSJ Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-2 PE=2 SV=1 76 385 4.0E-119
sp|Q3LSN4|LIAS1_PEA Lipoyl synthase 1, mitochondrial OS=Pisum sativum GN=LIP1-1 PE=2 SV=1 51 379 2.0E-118
sp|D0NP70|LIPA_PHYIT Lipoyl synthase, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_14852 PE=3 SV=1 77 382 3.0E-118
sp|Q3LSN5|LIAS2_PEA Lipoyl synthase 2, mitochondrial OS=Pisum sativum GN=LIP1-2 PE=2 SV=1 51 379 5.0E-118
sp|A9NNH7|LIAS_PICSI Lipoyl synthase, mitochondrial OS=Picea sitchensis GN=LIP1 PE=2 SV=1 79 388 8.0E-118
sp|B7FM45|LIAS_MEDTR Lipoyl synthase, mitochondrial OS=Medicago truncatula GN=LIP1 PE=2 SV=1 51 379 2.0E-117
sp|B8A031|LIAS_MAIZE Lipoyl synthase, mitochondrial OS=Zea mays GN=LIP1 PE=2 SV=1 6 379 9.0E-117
sp|C5Y9R0|LIAS_SORBI Lipoyl synthase, mitochondrial OS=Sorghum bicolor GN=LIP1 PE=3 SV=1 88 379 1.0E-116
sp|A2XU53|LIAS_ORYSI Lipoyl synthase, mitochondrial OS=Oryza sativa subsp. indica GN=LIP1 PE=3 SV=2 88 379 3.0E-116
sp|B9H5L9|LIAS_POPTR Lipoyl synthase, mitochondrial OS=Populus trichocarpa GN=LIP1 PE=3 SV=1 90 379 5.0E-116
sp|Q7XRF1|LIAS_ORYSJ Lipoyl synthase, mitochondrial OS=Oryza sativa subsp. japonica GN=LIP1 PE=2 SV=2 88 379 1.0E-115
sp|Q9ZWT1|LIAS_ARATH Lipoyl synthase, mitochondrial OS=Arabidopsis thaliana GN=LIP1 PE=2 SV=1 90 379 1.0E-115
sp|B7G3Y9|LIPA2_PHATC Lipoyl synthase 2, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_28652 PE=3 SV=1 88 398 3.0E-115
sp|Q4DYL7|LIPA2_TRYCC Lipoyl synthase 2, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053506211.10 PE=3 SV=1 73 383 1.0E-114
sp|Q4DC43|LIPA1_TRYCC Lipoyl synthase 1, mitochondrial OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511291.30 PE=3 SV=1 73 383 1.0E-114
sp|B9I666|LISC1_POPTR Lipoyl synthase 1, chloroplastic OS=Populus trichocarpa GN=LIP1P-1 PE=3 SV=1 29 385 4.0E-114
sp|A5K883|LIPA_PLAVS Lipoyl synthase, apicoplast OS=Plasmodium vivax (strain Salvador I) GN=lipA PE=3 SV=1 88 386 5.0E-114
sp|B3L8F2|LIPA_PLAKH Lipoyl synthase, apicoplast OS=Plasmodium knowlesi (strain H) GN=lipA PE=3 SV=1 88 389 8.0E-113
sp|B9N2B0|LISC2_POPTR Lipoyl synthase 2, chloroplastic OS=Populus trichocarpa GN=LIP1P-2 PE=3 SV=1 73 385 8.0E-113
sp|Q8LEE8|LISC_ARATH Lipoyl synthase, chloroplastic OS=Arabidopsis thaliana GN=LIP1P PE=2 SV=2 65 381 1.0E-112
sp|A4HY57|LIPA_LEIIN Lipoyl synthase, mitochondrial OS=Leishmania infantum GN=LinJ19.0190 PE=3 SV=1 66 382 1.0E-111
sp|C0PN26|LISC2_MAIZE Lipoyl synthase 2, chloroplastic OS=Zea mays GN=LIP1P-2 PE=2 SV=1 73 394 8.0E-111
sp|Q4QDI6|LIPA_LEIMA Lipoyl synthase, mitochondrial OS=Leishmania major GN=LmjF19.0350 PE=3 SV=1 39 382 4.0E-110
sp|A7HBU9|LIPA_ANADF Lipoyl synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lipA PE=3 SV=1 86 382 6.0E-110
sp|B6TN12|LISC1_MAIZE Lipoyl synthase 1, chloroplastic OS=Zea mays GN=LIP1P-1 PE=2 SV=1 73 381 8.0E-110
sp|Q2IIW6|LIPA_ANADE Lipoyl synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lipA PE=3 SV=2 88 382 8.0E-110
sp|C5XKZ1|LISC_SORBI Lipoyl synthase, chloroplastic OS=Sorghum bicolor GN=LIP1P PE=3 SV=1 73 381 3.0E-109
sp|Q5ZAQ2|LISC1_ORYSJ Lipoyl synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-1 PE=3 SV=1 76 381 5.0E-109
sp|B8AA76|LISC1_ORYSI Lipoyl synthase 1, chloroplastic OS=Oryza sativa subsp. indica GN=LIP1P-1 PE=3 SV=2 76 381 5.0E-109
sp|A8I2V9|LISC_CHLRE Lipoyl synthase, chloroplastic OS=Chlamydomonas reinhardtii GN=LIP1P PE=3 SV=1 88 391 2.0E-108
sp|A4RW69|LISC_OSTLU Lipoyl synthase, chloroplastic OS=Ostreococcus lucimarinus (strain CCE9901) GN=LIP1P PE=3 SV=1 69 383 1.0E-107
sp|Q86G50|LIPA_TOXGO Lipoyl synthase, apicoplast OS=Toxoplasma gondii GN=lipA PE=2 SV=1 88 379 4.0E-106
sp|Q9HN78|LIPA_HALSA Probable lipoyl synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lipA PE=3 SV=1 86 381 8.0E-104
sp|B0R7C4|LIPA_HALS3 Probable lipoyl synthase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=lipA PE=3 SV=1 86 381 8.0E-104
sp|B9LR22|LIPA_HALLT Probable lipoyl synthase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=lipA PE=3 SV=1 86 381 3.0E-103
sp|B9RW49|LIAS_RICCO Lipoyl synthase, mitochondrial OS=Ricinus communis GN=LIP1 PE=3 SV=1 90 357 7.0E-103
sp|A4H9Z3|LIPA_LEIBR Lipoyl synthase, mitochondrial OS=Leishmania braziliensis GN=LbrM19_V2.0670 PE=3 SV=1 73 386 6.0E-102
sp|Q3IU11|LIPA_NATPD Probable lipoyl synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=lipA PE=3 SV=1 86 380 3.0E-100
sp|Q5SLQ4|LIPA_THET8 Lipoyl synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=lipA PE=3 SV=1 63 380 2.0E-99
sp|Q72GV1|LIPA_THET2 Lipoyl synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=lipA PE=3 SV=1 63 380 2.0E-99
sp|Q1D4N0|LIPA_MYXXD Lipoyl synthase OS=Myxococcus xanthus (strain DK 1622) GN=lipA PE=3 SV=2 85 386 3.0E-98
sp|Q5WYF5|LIPA_LEGPL Lipoyl synthase OS=Legionella pneumophila (strain Lens) GN=lipA PE=3 SV=1 56 374 7.0E-98
sp|A1U380|LIPA_MARHV Lipoyl synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=lipA PE=3 SV=1 78 379 1.0E-97
sp|Q5ZXI6|LIPA_LEGPH Lipoyl synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lipA PE=3 SV=1 56 374 1.0E-97
sp|Q5X703|LIPA_LEGPA Lipoyl synthase OS=Legionella pneumophila (strain Paris) GN=lipA PE=3 SV=1 56 374 1.0E-97
sp|A9FD62|LIPA_SORC5 Lipoyl synthase OS=Sorangium cellulosum (strain So ce56) GN=lipA PE=3 SV=1 88 397 2.0E-97
sp|A5IGG3|LIPA_LEGPC Lipoyl synthase OS=Legionella pneumophila (strain Corby) GN=lipA PE=3 SV=1 56 374 2.0E-97
sp|Q1IXJ7|LIPA_DEIGD Lipoyl synthase OS=Deinococcus geothermalis (strain DSM 11300) GN=lipA PE=3 SV=1 88 377 1.0E-95
sp|A1WT98|LIPA_HALHL Lipoyl synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=lipA PE=3 SV=1 78 377 2.0E-95
sp|Q9RWA4|LIPA_DEIRA Lipoyl synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lipA PE=3 SV=1 88 384 1.0E-94
sp|A4WK38|LIPA_PYRAR Probable lipoyl synthase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=lipA PE=3 SV=1 84 374 1.0E-93
sp|Q9Y9E3|LIPA_AERPE Probable lipoyl synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=lipA PE=3 SV=2 100 383 1.0E-92
sp|A4XYX3|LIPA_PSEMY Lipoyl synthase OS=Pseudomonas mendocina (strain ymp) GN=lipA PE=3 SV=1 58 379 2.0E-92
sp|A3MW09|LIPA_PYRCJ Probable lipoyl synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=lipA PE=3 SV=1 87 384 2.0E-92
sp|Q0BM68|LIPA_FRATO Lipoyl synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lipA PE=3 SV=1 86 379 2.0E-92
sp|Q2A3R2|LIPA_FRATH Lipoyl synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lipA PE=3 SV=1 86 379 2.0E-92
sp|A7NBV0|LIPA_FRATF Lipoyl synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=lipA PE=3 SV=1 86 379 2.0E-92
sp|A4IY90|LIPA_FRATW Lipoyl synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=lipA PE=3 SV=1 86 379 2.0E-92
sp|Q5NH21|LIPA_FRATT Lipoyl synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lipA PE=3 SV=1 86 379 2.0E-92
sp|A0Q6Q2|LIPA_FRATN Lipoyl synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=lipA PE=3 SV=1 86 379 2.0E-92
sp|Q14IH3|LIPA_FRAT1 Lipoyl synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lipA PE=3 SV=1 86 379 2.0E-92
sp|B2SH72|LIPA_FRATM Lipoyl synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=lipA PE=3 SV=1 86 379 3.0E-92
sp|B0TZD6|LIPA_FRAP2 Lipoyl synthase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=lipA PE=3 SV=1 78 379 3.0E-91
sp|Q4JBV4|LIPA_SULAC Probable lipoyl synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=lipA PE=3 SV=1 91 387 7.0E-90
sp|Q97U63|LIPA_SULSO Probable lipoyl synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lipA PE=3 SV=1 92 377 1.0E-89
sp|Q67MF5|LIPA_SYMTH Lipoyl synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lipA PE=3 SV=1 75 381 5.0E-89
sp|Q8ERL8|LIPA_OCEIH Lipoyl synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lipA PE=3 SV=1 81 372 1.0E-88
sp|Q0A8A4|LIPA_ALKEH Lipoyl synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lipA PE=3 SV=1 73 377 1.0E-87
sp|Q9K7C9|LIPA_BACHD Lipoyl synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lipA PE=3 SV=1 79 383 6.0E-86
sp|Q4L4T8|LIPA_STAHJ Lipoyl synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lipA PE=3 SV=2 80 388 3.0E-85
sp|B9MQ24|LIPA_CALBD Lipoyl synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lipA PE=3 SV=1 88 378 3.0E-85
sp|Q49W64|LIPA_STAS1 Lipoyl synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lipA PE=3 SV=1 80 389 8.0E-85
sp|C5D7H5|LIPA_GEOSW Lipoyl synthase OS=Geobacillus sp. (strain WCH70) GN=lipA PE=3 SV=1 86 372 9.0E-85
sp|Q5KVM7|LIPA_GEOKA Lipoyl synthase OS=Geobacillus kaustophilus (strain HTA426) GN=lipA PE=3 SV=2 85 376 1.0E-84
sp|Q8CPW4|LIPA_STAES Lipoyl synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lipA PE=3 SV=1 84 388 3.0E-84
sp|Q5HQN7|LIPA_STAEQ Lipoyl synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lipA PE=3 SV=1 84 388 3.0E-84
sp|Q2YWR5|LIPA_STAAB Lipoyl synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lipA PE=3 SV=1 80 385 4.0E-84
sp|P65287|LIPA_STAAW Lipoyl synthase OS=Staphylococcus aureus (strain MW2) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|A8Z1I3|LIPA_STAAT Lipoyl synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|Q6GB01|LIPA_STAAS Lipoyl synthase OS=Staphylococcus aureus (strain MSSA476) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|Q6GIG3|LIPA_STAAR Lipoyl synthase OS=Staphylococcus aureus (strain MRSA252) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|P65286|LIPA_STAAN Lipoyl synthase OS=Staphylococcus aureus (strain N315) GN=lipA PE=1 SV=1 80 385 6.0E-84
sp|P65285|LIPA_STAAM Lipoyl synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|A6QFD6|LIPA_STAAE Lipoyl synthase OS=Staphylococcus aureus (strain Newman) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|Q5HHG0|LIPA_STAAC Lipoyl synthase OS=Staphylococcus aureus (strain COL) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|A5IRA1|LIPA_STAA9 Lipoyl synthase OS=Staphylococcus aureus (strain JH9) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|Q2FZX4|LIPA_STAA8 Lipoyl synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|Q2FIE9|LIPA_STAA3 Lipoyl synthase OS=Staphylococcus aureus (strain USA300) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|A6U030|LIPA_STAA2 Lipoyl synthase OS=Staphylococcus aureus (strain JH1) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|A7X0C7|LIPA_STAA1 Lipoyl synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lipA PE=3 SV=1 80 385 6.0E-84
sp|Q2GKX7|LIPA_ANAPZ Lipoyl synthase OS=Anaplasma phagocytophilum (strain HZ) GN=lipA PE=3 SV=1 88 375 8.0E-84
sp|Q6L1L7|LIPA_PICTO Probable lipoyl synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=lipA PE=3 SV=1 88 376 2.0E-83
sp|A4ISG5|LIPA_GEOTN Lipoyl synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lipA PE=3 SV=1 85 376 2.0E-83
sp|O32129|LIPA_BACSU Lipoyl synthase OS=Bacillus subtilis (strain 168) GN=lipA PE=1 SV=2 79 383 2.0E-83
sp|B9DIX8|LIPA_STACT Lipoyl synthase OS=Staphylococcus carnosus (strain TM300) GN=lipA PE=3 SV=1 80 388 2.0E-83
sp|Q5WDS6|LIPA_BACSK Lipoyl synthase OS=Bacillus clausii (strain KSM-K16) GN=lipA PE=3 SV=1 86 387 2.0E-83
sp|A7Z8E8|LIPA_BACMF Lipoyl synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=lipA PE=3 SV=1 79 383 6.0E-83
sp|Q1AT13|LIPA_RUBXD Lipoyl synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=lipA PE=3 SV=1 88 372 2.0E-82
sp|B9EAJ9|LIPA_MACCJ Lipoyl synthase OS=Macrococcus caseolyticus (strain JCSC5402) GN=lipA PE=3 SV=1 80 385 2.0E-82
sp|Q8R9E1|LIPA_CALS4 Lipoyl synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lipA PE=3 SV=1 85 370 3.0E-82
sp|Q0VN36|LIPA_ALCBS Lipoyl synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=lipA PE=3 SV=1 64 370 5.0E-82
sp|Q2NAD7|LIPA_ERYLH Lipoyl synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=lipA PE=3 SV=1 77 376 1.0E-81
sp|A8FH34|LIPA_BACP2 Lipoyl synthase OS=Bacillus pumilus (strain SAFR-032) GN=lipA PE=3 SV=1 79 383 2.0E-81
sp|Q0W150|LIPA_METAR Probable lipoyl synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=lipA PE=3 SV=1 88 382 2.0E-81
sp|Q2GGX7|LIPA_EHRCR Lipoyl synthase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=lipA PE=3 SV=1 88 374 2.0E-81
sp|A7GUG3|LIPA_BACCN Lipoyl synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lipA PE=3 SV=1 80 372 3.0E-81
sp|Q89LR6|LIPA1_BRADU Lipoyl synthase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lipA1 PE=3 SV=1 88 374 3.0E-81
sp|B7HCZ6|LIPA_BACC4 Lipoyl synthase OS=Bacillus cereus (strain B4264) GN=lipA PE=3 SV=1 80 372 5.0E-81
sp|B7IMZ7|LIPA_BACC2 Lipoyl synthase OS=Bacillus cereus (strain G9842) GN=lipA PE=3 SV=1 80 372 6.0E-81
sp|Q68W08|LIPA_RICTY Lipoyl synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lipA PE=3 SV=1 83 374 6.0E-81
sp|Q816A0|LIPA_BACCR Lipoyl synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lipA PE=3 SV=1 80 372 7.0E-81
sp|Q2RHM6|LIPA_MOOTA Lipoyl synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=lipA PE=3 SV=1 86 372 8.0E-81
sp|Q631Z7|LIPA_BACCZ Lipoyl synthase OS=Bacillus cereus (strain ZK / E33L) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|B9J3H2|LIPA_BACCQ Lipoyl synthase OS=Bacillus cereus (strain Q1) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|B7HUW3|LIPA_BACC7 Lipoyl synthase OS=Bacillus cereus (strain AH187) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|Q72YB2|LIPA_BACC1 Lipoyl synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|Q6HBT4|LIPA_BACHK Lipoyl synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|B7JDM3|LIPA_BACC0 Lipoyl synthase OS=Bacillus cereus (strain AH820) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|Q81XM8|LIPA_BACAN Lipoyl synthase OS=Bacillus anthracis GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|C3LCA6|LIPA_BACAC Lipoyl synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|C3PDK2|LIPA_BACAA Lipoyl synthase OS=Bacillus anthracis (strain A0248) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|A9VNX6|LIPA_BACWK Lipoyl synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|C1EY56|LIPA_BACC3 Lipoyl synthase OS=Bacillus cereus (strain 03BB102) GN=lipA PE=3 SV=1 80 372 1.0E-80
sp|A0RKF7|LIPA_BACAH Lipoyl synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=lipA PE=3 SV=2 80 372 1.0E-80
sp|Q3YRT2|LIPA_EHRCJ Lipoyl synthase OS=Ehrlichia canis (strain Jake) GN=lipA PE=3 SV=1 88 374 3.0E-80
sp|Q2G712|LIPA_NOVAD Lipoyl synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=lipA PE=3 SV=1 86 374 5.0E-80
sp|Q5GSY2|LIPA_WOLTR Lipoyl synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=lipA PE=3 SV=1 88 374 6.0E-80
sp|Q8ZUR9|LIPA_PYRAE Probable lipoyl synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=lipA PE=3 SV=1 87 370 8.0E-80
sp|A8GUH3|LIPA_RICB8 Lipoyl synthase OS=Rickettsia bellii (strain OSU 85-389) GN=lipA PE=3 SV=2 84 374 1.0E-79
sp|A8I4L8|LIPA_AZOC5 Lipoyl synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lipA PE=3 SV=1 84 374 2.0E-79
sp|Q1GTM7|LIPA_SPHAL Lipoyl synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=lipA PE=3 SV=1 86 374 2.0E-79
sp|A8F2M4|LIPA_RICM5 Lipoyl synthase OS=Rickettsia massiliae (strain Mtu5) GN=lipA PE=3 SV=1 83 374 2.0E-79
sp|Q1RGX4|LIPA_RICBR Lipoyl synthase OS=Rickettsia bellii (strain RML369-C) GN=lipA PE=3 SV=1 84 374 3.0E-79
sp|B6IQ36|LIPA_RHOCS Lipoyl synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=lipA PE=3 SV=1 84 374 3.0E-79
sp|A7IM78|LIPA_XANP2 Lipoyl synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lipA PE=3 SV=1 84 374 4.0E-79
sp|Q4UK97|LIPA_RICFE Lipoyl synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=lipA PE=3 SV=2 83 374 8.0E-79
sp|A8GTI8|LIPA_RICRS Lipoyl synthase OS=Rickettsia rickettsii (strain Sheila Smith) GN=lipA PE=3 SV=1 83 374 1.0E-78
sp|B0BV26|LIPA_RICRO Lipoyl synthase OS=Rickettsia rickettsii (strain Iowa) GN=lipA PE=3 SV=1 83 374 1.0E-78
sp|C4K1I0|LIPA_RICPU Lipoyl synthase OS=Rickettsia peacockii (strain Rustic) GN=lipA PE=3 SV=1 83 374 1.0E-78
sp|Q92GH8|LIPA_RICCN Lipoyl synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=lipA PE=3 SV=2 83 374 1.0E-78
sp|A8EZU2|LIPA_RICCK Lipoyl synthase OS=Rickettsia canadensis (strain McKiel) GN=lipA PE=3 SV=1 83 374 1.0E-78
sp|C3PLL8|LIPA_RICAE Lipoyl synthase OS=Rickettsia africae (strain ESF-5) GN=lipA PE=3 SV=1 83 374 1.0E-78
sp|Q1GGW2|LIPA_RUEST Lipoyl synthase OS=Ruegeria sp. (strain TM1040) GN=lipA PE=3 SV=2 88 374 2.0E-78
sp|A4XHV2|LIPA_CALS8 Lipoyl synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lipA PE=3 SV=1 85 372 2.0E-78
sp|A5CCM4|LIPA_ORITB Lipoyl synthase OS=Orientia tsutsugamushi (strain Boryong) GN=lipA PE=3 SV=1 88 374 2.0E-78
sp|A6T689|LIPA_KLEP7 Lipoyl synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lipA PE=3 SV=1 80 370 2.0E-78
sp|B5XZS6|LIPA_KLEP3 Lipoyl synthase OS=Klebsiella pneumoniae (strain 342) GN=lipA PE=3 SV=1 80 370 2.0E-78
sp|A8GB09|LIPA_SERP5 Lipoyl synthase OS=Serratia proteamaculans (strain 568) GN=lipA PE=3 SV=1 80 370 2.0E-78
sp|C6DBV6|LIPA_PECCP Lipoyl synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=lipA PE=3 SV=1 80 370 3.0E-78
sp|A4WRC8|LIPA_RHOS5 Lipoyl synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=lipA PE=3 SV=1 86 374 3.0E-78
sp|A7HXW0|LIPA_PARL1 Lipoyl synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=lipA PE=3 SV=1 84 374 5.0E-78
sp|O05959|LIPA_RICPR Lipoyl synthase OS=Rickettsia prowazekii (strain Madrid E) GN=lipA PE=3 SV=1 83 388 6.0E-78
sp|Q5HB02|LIPA_EHRRW Lipoyl synthase OS=Ehrlichia ruminantium (strain Welgevonden) GN=lipA PE=3 SV=1 88 374 8.0E-78
sp|Q5FFK4|LIPA_EHRRG Lipoyl synthase OS=Ehrlichia ruminantium (strain Gardel) GN=lipA PE=3 SV=1 88 374 8.0E-78
sp|P61200|LIPA_WOLPM Lipoyl synthase OS=Wolbachia pipientis wMel GN=lipA PE=3 SV=1 88 374 8.0E-78
sp|B9KSE2|LIPA_RHOSK Lipoyl synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=lipA PE=3 SV=1 88 384 1.0E-77
sp|Q3J2P4|LIPA_RHOS4 Lipoyl synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=lipA PE=3 SV=1 88 384 1.0E-77
sp|A3PJL9|LIPA_RHOS1 Lipoyl synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=lipA PE=3 SV=1 88 384 1.0E-77
sp|A1B1T3|LIPA_PARDP Lipoyl synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=lipA PE=3 SV=1 88 376 1.0E-77
sp|A5CWR6|LIPA_VESOH Lipoyl synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=lipA PE=3 SV=1 82 371 1.0E-77
sp|C0R2Q4|LIPA_WOLWR Lipoyl synthase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=lipA PE=3 SV=1 88 374 1.0E-77
sp|C1D5T3|LIPA_LARHH Lipoyl synthase OS=Laribacter hongkongensis (strain HLHK9) GN=lipA PE=3 SV=1 86 372 2.0E-77
sp|B4EV01|LIPA_PROMH Lipoyl synthase OS=Proteus mirabilis (strain HI4320) GN=lipA PE=3 SV=1 80 370 2.0E-77
sp|B3CQP5|LIPA_ORITI Lipoyl synthase OS=Orientia tsutsugamushi (strain Ikeda) GN=lipA PE=3 SV=1 88 374 2.0E-77
sp|Q2GE84|LIPA_NEOSM Lipoyl synthase OS=Neorickettsia sennetsu (strain Miyayama) GN=lipA PE=3 SV=1 114 384 3.0E-77
sp|A8GPR5|LIPA_RICAH Lipoyl synthase OS=Rickettsia akari (strain Hartford) GN=lipA PE=3 SV=1 83 374 3.0E-77
sp|B7LLI3|LIPA_ESCF3 Lipoyl synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=lipA PE=3 SV=1 80 370 3.0E-77
sp|Q6D7M8|LIPA_PECAS Lipoyl synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lipA PE=3 SV=1 80 370 3.0E-77
sp|A7MNP9|LIPA_CROS8 Lipoyl synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lipA PE=3 SV=1 80 370 4.0E-77
sp|B1JGB7|LIPA_YERPY Lipoyl synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lipA PE=3 SV=1 80 370 7.0E-77
sp|Q66DF5|LIPA_YERPS Lipoyl synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lipA PE=3 SV=1 80 370 7.0E-77
sp|A4TP09|LIPA_YERPP Lipoyl synthase OS=Yersinia pestis (strain Pestoides F) GN=lipA PE=3 SV=1 80 370 7.0E-77
sp|Q1CKR6|LIPA_YERPN Lipoyl synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lipA PE=3 SV=1 80 370 7.0E-77
sp|A9R703|LIPA_YERPG Lipoyl synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lipA PE=3 SV=1 80 370 7.0E-77
sp|Q8ZDH0|LIPA_YERPE Lipoyl synthase OS=Yersinia pestis GN=lipA PE=3 SV=1 80 370 7.0E-77
sp|B2K874|LIPA_YERPB Lipoyl synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lipA PE=3 SV=1 80 370 7.0E-77
sp|Q1C507|LIPA_YERPA Lipoyl synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lipA PE=3 SV=1 80 370 7.0E-77
sp|A7FKY9|LIPA_YERP3 Lipoyl synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lipA PE=3 SV=1 80 370 7.0E-77
sp|Q9A7I8|LIPA_CAUCR Lipoyl synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lipA PE=3 SV=1 84 383 8.0E-77
sp|B8GW82|LIPA_CAUCN Lipoyl synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lipA PE=3 SV=1 84 383 8.0E-77
sp|A4W814|LIPA_ENT38 Lipoyl synthase OS=Enterobacter sp. (strain 638) GN=lipA PE=3 SV=1 80 370 9.0E-77
sp|A4YUR5|LIPA_BRASO Lipoyl synthase OS=Bradyrhizobium sp. (strain ORS278) GN=lipA PE=3 SV=1 88 374 1.0E-76
sp|B3CP16|LIPA_WOLPP Lipoyl synthase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=lipA PE=3 SV=1 88 374 2.0E-76
sp|A1JPR9|LIPA_YERE8 Lipoyl synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lipA PE=3 SV=1 80 370 2.0E-76
sp|B2VBK1|LIPA_ERWT9 Lipoyl synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lipA PE=3 SV=1 84 370 3.0E-76
sp|A5V2U6|LIPA_SPHWW Lipoyl synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lipA PE=3 SV=1 59 376 4.0E-76
sp|Q3Z4G4|LIPA_SHISS Lipoyl synthase OS=Shigella sonnei (strain Ss046) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|P60719|LIPA_SHIFL Lipoyl synthase OS=Shigella flexneri GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|Q0T6N8|LIPA_SHIF8 Lipoyl synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=lipA PE=3 SV=2 80 370 4.0E-76
sp|Q32IV2|LIPA_SHIDS Lipoyl synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|Q324R5|LIPA_SHIBS Lipoyl synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|Q1RET3|LIPA_ECOUT Lipoyl synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B1LKL9|LIPA_ECOSM Lipoyl synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B6I137|LIPA_ECOSE Lipoyl synthase OS=Escherichia coli (strain SE11) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B7N9N3|LIPA_ECOLU Lipoyl synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|P60716|LIPA_ECOLI Lipoyl synthase OS=Escherichia coli (strain K12) GN=lipA PE=1 SV=1 80 370 4.0E-76
sp|B1IYI0|LIPA_ECOLC Lipoyl synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|P60717|LIPA_ECOL6 Lipoyl synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|Q0TK45|LIPA_ECOL5 Lipoyl synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|A1A8Q3|LIPA_ECOK1 Lipoyl synthase OS=Escherichia coli O1:K1 / APEC GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|A7ZXQ4|LIPA_ECOHS Lipoyl synthase OS=Escherichia coli O9:H4 (strain HS) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|C4ZWB5|LIPA_ECOBW Lipoyl synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B7M5F5|LIPA_ECO8A Lipoyl synthase OS=Escherichia coli O8 (strain IAI1) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B7MRR5|LIPA_ECO81 Lipoyl synthase OS=Escherichia coli O81 (strain ED1a) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B7NLY7|LIPA_ECO7I Lipoyl synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B5YQH9|LIPA_ECO5E Lipoyl synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|P60718|LIPA_ECO57 Lipoyl synthase OS=Escherichia coli O157:H7 GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B7L9H2|LIPA_ECO55 Lipoyl synthase OS=Escherichia coli (strain 55989 / EAEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B7MFQ1|LIPA_ECO45 Lipoyl synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B7UKR9|LIPA_ECO27 Lipoyl synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|A7ZJ15|LIPA_ECO24 Lipoyl synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|B2TTI9|LIPA_SHIB3 Lipoyl synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lipA PE=3 SV=1 80 370 4.0E-76
sp|A1AMT5|LIPA_PELPD Lipoyl synthase OS=Pelobacter propionicus (strain DSM 2379) GN=lipA PE=3 SV=1 63 370 4.0E-76
sp|C5BGD9|LIPA_EDWI9 Lipoyl synthase OS=Edwardsiella ictaluri (strain 93-146) GN=lipA PE=3 SV=1 80 370 6.0E-76
sp|Q2NUV8|LIPA_SODGM Lipoyl synthase OS=Sodalis glossinidius (strain morsitans) GN=lipA PE=3 SV=1 80 370 6.0E-76
sp|Q7W0K8|LIPA_BORPE Lipoyl synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lipA PE=3 SV=1 61 372 7.0E-76
sp|Q7WR00|LIPA_BORBR Lipoyl synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lipA PE=3 SV=1 61 372 7.0E-76
sp|Q5PAD4|LIPA_ANAMM Lipoyl synthase OS=Anaplasma marginale (strain St. Maries) GN=lipA PE=3 SV=2 88 374 8.0E-76
sp|Q2L1D8|LIPA_BORA1 Lipoyl synthase OS=Bordetella avium (strain 197N) GN=lipA PE=3 SV=1 88 372 8.0E-76
sp|Q1II13|LIPA_KORVE Lipoyl synthase OS=Koribacter versatilis (strain Ellin345) GN=lipA PE=3 SV=1 88 372 1.0E-75
sp|Q7N767|LIPA_PHOLL Lipoyl synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lipA PE=3 SV=1 84 370 2.0E-75
sp|B8EJU1|LIPA_METSB Lipoyl synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=lipA PE=3 SV=1 86 396 2.0E-75
sp|A5EIM5|LIPA_BRASB Lipoyl synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=lipA PE=3 SV=1 88 374 2.0E-75
sp|A9MKE4|LIPA_SALAR Lipoyl synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lipA PE=3 SV=1 80 370 2.0E-75
sp|Q7W222|LIPA_BORPA Lipoyl synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lipA PE=3 SV=1 61 372 3.0E-75
sp|Q8YXD1|LIPA2_NOSS1 Lipoyl synthase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lipA2 PE=3 SV=1 81 372 4.0E-75
sp|A1AWI8|LIPA_RUTMC Lipoyl synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=lipA PE=3 SV=1 74 370 4.0E-75
sp|Q8ZR04|LIPA_SALTY Lipoyl synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|B4TPA3|LIPA_SALSV Lipoyl synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|B5BCG1|LIPA_SALPK Lipoyl synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|C0PW62|LIPA_SALPC Lipoyl synthase OS=Salmonella paratyphi C (strain RKS4594) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|A9MV74|LIPA_SALPB Lipoyl synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|Q5PM97|LIPA_SALPA Lipoyl synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|B4SYJ0|LIPA_SALNS Lipoyl synthase OS=Salmonella newport (strain SL254) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|B4TAI5|LIPA_SALHS Lipoyl synthase OS=Salmonella heidelberg (strain SL476) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|B5R7Y1|LIPA_SALG2 Lipoyl synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|B5QVN4|LIPA_SALEP Lipoyl synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|B5FMM8|LIPA_SALDC Lipoyl synthase OS=Salmonella dublin (strain CT_02021853) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|Q57RU3|LIPA_SALCH Lipoyl synthase OS=Salmonella choleraesuis (strain SC-B67) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|B5EZ72|LIPA_SALA4 Lipoyl synthase OS=Salmonella agona (strain SL483) GN=lipA PE=3 SV=1 80 370 4.0E-75
sp|Q1GYC1|LIPA_METFK Lipoyl synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lipA PE=3 SV=1 86 370 5.0E-75
sp|Q3SSP1|LIPA_NITWN Lipoyl synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lipA PE=3 SV=1 88 374 5.0E-75
sp|Q5QYE5|LIPA_IDILO Lipoyl synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lipA PE=3 SV=2 65 370 5.0E-75
sp|B3QIL2|LIPA_RHOPT Lipoyl synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=lipA PE=3 SV=1 88 374 6.0E-75
sp|P61198|LIPA_RHOPA Lipoyl synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lipA PE=3 SV=1 88 374 6.0E-75
sp|Q8Z8I3|LIPA_SALTI Lipoyl synthase OS=Salmonella typhi GN=lipA PE=3 SV=1 80 370 8.0E-75
sp|Q3IJ81|LIPA_PSEHT Lipoyl synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=lipA PE=3 SV=1 69 372 1.0E-74
sp|A6LE09|LIPA_PARD8 Lipoyl synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lipA PE=3 SV=1 86 370 1.0E-74
sp|B1ZEL4|LIPA_METPB Lipoyl synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=lipA PE=3 SV=1 84 374 1.0E-74
sp|Q07MZ5|LIPA_RHOP5 Lipoyl synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=lipA PE=3 SV=1 88 374 1.0E-74
sp|B9LM70|LIPA_CHLSY Lipoyl synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=lipA PE=3 SV=1 86 370 1.0E-74
sp|A9WEM1|LIPA_CHLAA Lipoyl synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=lipA PE=3 SV=1 86 370 1.0E-74
sp|A4J247|LIPA_DESRM Lipoyl synthase OS=Desulfotomaculum reducens (strain MI-1) GN=lipA PE=3 SV=1 86 373 2.0E-74
sp|B7KRC9|LIPA_METC4 Lipoyl synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=lipA PE=3 SV=1 84 374 2.0E-74
sp|B2RKU2|LIPA_PORG3 Lipoyl synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lipA PE=3 SV=1 88 370 2.0E-74
sp|Q7MWT4|LIPA_PORGI Lipoyl synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lipA PE=3 SV=1 88 370 2.0E-74
sp|A8AJH6|LIPA_CITK8 Lipoyl synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lipA PE=3 SV=1 80 370 2.0E-74
sp|B8F679|LIPA_HAEPS Lipoyl synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=lipA PE=3 SV=1 74 370 2.0E-74
sp|Q5FNM1|LIPA_GLUOX Lipoyl synthase OS=Gluconobacter oxydans (strain 621H) GN=lipA PE=3 SV=1 84 374 2.0E-74
sp|Q11HV6|LIPA_CHESB Lipoyl synthase OS=Chelativorans sp. (strain BNC1) GN=lipA PE=3 SV=1 57 374 3.0E-74
sp|Q1QMA2|LIPA_NITHX Lipoyl synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lipA PE=3 SV=1 88 374 3.0E-74
sp|A9W6I4|LIPA_METEP Lipoyl synthase OS=Methylobacterium extorquens (strain PA1) GN=lipA PE=3 SV=1 84 374 4.0E-74
sp|A5FNF9|LIPA_FLAJ1 Lipoyl synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lipA PE=3 SV=1 88 370 4.0E-74
sp|A4SEG3|LIPA_CHLPM Lipoyl synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=lipA PE=3 SV=1 86 371 5.0E-74
sp|B2IB58|LIPA_BEII9 Lipoyl synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=lipA PE=3 SV=1 58 374 5.0E-74
sp|Q7NTF9|LIPA_CHRVO Lipoyl synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lipA PE=3 SV=1 88 370 5.0E-74
sp|C3K2L8|LIPA_PSEFS Lipoyl synthase OS=Pseudomonas fluorescens (strain SBW25) GN=lipA PE=3 SV=1 88 372 6.0E-74
sp|B8G782|LIPA_CHLAD Lipoyl synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=lipA PE=3 SV=1 59 370 7.0E-74
sp|A6U8F5|LIPA_SINMW Lipoyl synthase OS=Sinorhizobium medicae (strain WSM419) GN=lipA PE=3 SV=1 84 374 8.0E-74
sp|Q8A029|LIPA_BACTN Lipoyl synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lipA PE=3 SV=1 86 370 9.0E-74
sp|Q8D325|LIPA_WIGBR Lipoyl synthase OS=Wigglesworthia glossinidia brevipalpis GN=lipA PE=3 SV=1 88 370 1.0E-73
sp|A5EVQ3|LIPA_DICNV Lipoyl synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=lipA PE=3 SV=1 88 370 1.0E-73
sp|B0TR57|LIPA_SHEHH Lipoyl synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=lipA PE=3 SV=1 80 370 1.0E-73
sp|Q7NFJ9|LIPA2_GLOVI Lipoyl synthase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=lipA2 PE=3 SV=1 85 372 1.0E-73
sp|A6X0M7|LIPA_OCHA4 Lipoyl synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=lipA PE=3 SV=1 83 374 1.0E-73
sp|Q8Y2L3|LIPA_RALSO Lipoyl synthase OS=Ralstonia solanacearum (strain GMI1000) GN=lipA PE=3 SV=1 88 372 1.0E-73
sp|Q6MEX3|LIPA_PARUW Lipoyl synthase OS=Protochlamydia amoebophila (strain UWE25) GN=lipA PE=3 SV=1 84 386 2.0E-73
sp|B4SJ16|LIPA_STRM5 Lipoyl synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=lipA PE=3 SV=1 84 370 2.0E-73
sp|B3PYS0|LIPA_RHIE6 Lipoyl synthase OS=Rhizobium etli (strain CIAT 652) GN=lipA PE=3 SV=1 84 374 2.0E-73
sp|A8Z609|LIPA_SULMW Lipoyl synthase OS=Sulcia muelleri (strain GWSS) GN=lipA PE=3 SV=1 80 370 2.0E-73
sp|A4SJV5|LIPA_AERS4 Lipoyl synthase OS=Aeromonas salmonicida (strain A449) GN=lipA PE=3 SV=1 84 370 3.0E-73
sp|B5ZNB1|LIPA_RHILW Lipoyl synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lipA PE=3 SV=1 84 374 3.0E-73
sp|Q1LTM3|LIPA_BAUCH Lipoyl synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=lipA PE=3 SV=1 88 370 4.0E-73
sp|Q0BSW6|LIPA_GRABC Lipoyl synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lipA PE=3 SV=2 88 374 4.0E-73
sp|A0KNA3|LIPA_AERHH Lipoyl synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lipA PE=3 SV=1 84 370 4.0E-73
sp|Q2T1K5|LIPA_BURTA Lipoyl synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lipA PE=3 SV=1 88 370 4.0E-73
sp|B2UE01|LIPA_RALPJ Lipoyl synthase OS=Ralstonia pickettii (strain 12J) GN=lipA PE=3 SV=1 88 372 5.0E-73
sp|A8H7D5|LIPA_SHEPA Lipoyl synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=lipA PE=3 SV=1 80 370 5.0E-73
sp|A1USA0|LIPA_BARBK Lipoyl synthase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=lipA PE=3 SV=1 83 386 6.0E-73
sp|Q8DLC2|LIPA2_THEEB Lipoyl synthase 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=lipA2 PE=1 SV=1 87 373 6.0E-73
sp|Q9EYP3|LIPA_BURPS Lipoyl synthase OS=Burkholderia pseudomallei (strain K96243) GN=lipA PE=3 SV=2 88 370 6.0E-73
sp|A3N576|LIPA_BURP6 Lipoyl synthase OS=Burkholderia pseudomallei (strain 668) GN=lipA PE=3 SV=1 88 370 6.0E-73
sp|Q3JWL1|LIPA_BURP1 Lipoyl synthase OS=Burkholderia pseudomallei (strain 1710b) GN=lipA PE=3 SV=1 88 370 6.0E-73
sp|A3NQX6|LIPA_BURP0 Lipoyl synthase OS=Burkholderia pseudomallei (strain 1106a) GN=lipA PE=3 SV=1 88 370 6.0E-73
sp|A5G2D2|LIPA_ACICJ Lipoyl synthase OS=Acidiphilium cryptum (strain JF-5) GN=lipA PE=3 SV=1 84 374 7.0E-73
sp|A0M4W4|LIPA_GRAFK Lipoyl synthase OS=Gramella forsetii (strain KT0803) GN=lipA PE=3 SV=1 88 370 7.0E-73
sp|Q9Z774|LIPA_CHLPN Lipoyl synthase OS=Chlamydia pneumoniae GN=lipA PE=3 SV=1 77 370 8.0E-73
sp|A1S8U1|LIPA_SHEAM Lipoyl synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=lipA PE=3 SV=1 80 370 8.0E-73
sp|Q3SM23|LIPA_THIDA Lipoyl synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=lipA PE=3 SV=1 86 368 8.0E-73
sp|Q6G401|LIPA_BARHE Lipoyl synthase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lipA PE=3 SV=1 83 386 9.0E-73
sp|B2FUS8|LIPA_STRMK Lipoyl synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=lipA PE=3 SV=1 84 370 1.0E-72
sp|Q1MH26|LIPA_RHIL3 Lipoyl synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=lipA PE=3 SV=1 84 374 1.0E-72
sp|Q2K8V9|LIPA_RHIEC Lipoyl synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lipA PE=3 SV=1 84 374 1.0E-72
sp|B8CSH7|LIPA_SHEPW Lipoyl synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=lipA PE=3 SV=1 80 370 1.0E-72
sp|B9JW84|LIPA_AGRVS Lipoyl synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=lipA PE=3 SV=1 84 374 1.0E-72
sp|Q3K6A4|LIPA_PSEPF Lipoyl synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=lipA PE=3 SV=1 88 372 1.0E-72
sp|Q256D6|LIPA_CHLFF Lipoyl synthase OS=Chlamydophila felis (strain Fe/C-56) GN=lipA PE=3 SV=1 77 391 1.0E-72
sp|Q087L5|LIPA_SHEFN Lipoyl synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=lipA PE=3 SV=1 80 370 2.0E-72
sp|A7TDI2|LIAS_NEMVE Lipoyl synthase, mitochondrial OS=Nematostella vectensis GN=v1g225637 PE=3 SV=1 88 370 2.0E-72
sp|P65282|LIPA_BRUSU Lipoyl synthase OS=Brucella suis biovar 1 (strain 1330) GN=lipA PE=3 SV=1 84 374 2.0E-72
sp|B0CGS4|LIPA_BRUSI Lipoyl synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lipA PE=3 SV=1 84 374 2.0E-72
sp|P65281|LIPA_BRUME Lipoyl synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=lipA PE=3 SV=1 84 374 2.0E-72
sp|C0RJ95|LIPA_BRUMB Lipoyl synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=lipA PE=3 SV=1 84 374 2.0E-72
sp|A9M5D7|LIPA_BRUC2 Lipoyl synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lipA PE=3 SV=1 84 374 2.0E-72
sp|Q57D15|LIPA_BRUAB Lipoyl synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=lipA PE=3 SV=1 84 374 2.0E-72
sp|Q2YPV8|LIPA_BRUA2 Lipoyl synthase OS=Brucella abortus (strain 2308) GN=lipA PE=3 SV=1 84 374 2.0E-72
sp|B2S5X5|LIPA_BRUA1 Lipoyl synthase OS=Brucella abortus (strain S19) GN=lipA PE=3 SV=1 84 374 2.0E-72
sp|Q2RT68|LIPA_RHORT Lipoyl synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=lipA PE=3 SV=1 86 374 2.0E-72
sp|B1LWN4|LIPA_METRJ Lipoyl synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=lipA PE=3 SV=1 88 374 2.0E-72
sp|A6TWC9|LIPA_ALKMQ Lipoyl synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=lipA PE=3 SV=1 83 374 2.0E-72
sp|Q8UFG1|LIPA_AGRFC Lipoyl synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lipA PE=3 SV=1 84 374 2.0E-72
sp|Q2SA38|LIPA_HAHCH Lipoyl synthase OS=Hahella chejuensis (strain KCTC 2396) GN=lipA PE=3 SV=1 84 370 3.0E-72
sp|Q5GVR7|LIPA_XANOR Lipoyl synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lipA PE=3 SV=1 84 370 3.0E-72
sp|Q2NYZ2|LIPA_XANOM Lipoyl synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lipA PE=3 SV=1 84 370 3.0E-72
sp|A5VQP8|LIPA_BRUO2 Lipoyl synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lipA PE=3 SV=1 84 374 3.0E-72
sp|A4VQZ6|LIPA_PSEU5 Lipoyl synthase OS=Pseudomonas stutzeri (strain A1501) GN=lipA PE=3 SV=1 88 372 3.0E-72
sp|A3QH60|LIPA_SHELP Lipoyl synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=lipA PE=3 SV=1 80 370 3.0E-72
sp|Q137C6|LIPA_RHOPS Lipoyl synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=lipA PE=3 SV=1 88 374 4.0E-72
sp|Q3BXQ3|LIPA_XANC5 Lipoyl synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lipA PE=3 SV=1 84 370 4.0E-72
sp|A1V016|LIPA_BURMS Lipoyl synthase OS=Burkholderia mallei (strain SAVP1) GN=lipA PE=3 SV=1 88 370 4.0E-72
sp|Q62N16|LIPA_BURMA Lipoyl synthase OS=Burkholderia mallei (strain ATCC 23344) GN=lipA PE=3 SV=1 88 370 4.0E-72
sp|A2S5Y9|LIPA_BURM9 Lipoyl synthase OS=Burkholderia mallei (strain NCTC 10229) GN=lipA PE=3 SV=1 88 370 4.0E-72
sp|A3MR17|LIPA_BURM7 Lipoyl synthase OS=Burkholderia mallei (strain NCTC 10247) GN=lipA PE=3 SV=1 88 370 4.0E-72
sp|B0SQ03|LIPA_LEPBP Lipoyl synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=lipA PE=3 SV=1 87 376 4.0E-72
sp|B0SGV6|LIPA_LEPBA Lipoyl synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=lipA PE=3 SV=1 87 376 4.0E-72
sp|B4RLK9|LIPA_NEIG2 Lipoyl synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=lipA PE=3 SV=1 88 384 4.0E-72
sp|Q5F8I0|LIPA_NEIG1 Lipoyl synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lipA PE=3 SV=1 88 384 4.0E-72
sp|Q2IW20|LIPA_RHOP2 Lipoyl synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=lipA PE=3 SV=1 88 374 5.0E-72
sp|A5US48|LIPA_ROSS1 Lipoyl synthase OS=Roseiflexus sp. (strain RS-1) GN=lipA PE=3 SV=1 86 370 5.0E-72
sp|Q9JUC8|LIPA_NEIMA Lipoyl synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lipA PE=3 SV=1 88 384 5.0E-72
sp|Q8PPL8|LIPA_XANAC Lipoyl synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lipA PE=3 SV=1 84 370 6.0E-72
sp|Q9RNY7|LIPA_ZYMMO Lipoyl synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lipA PE=3 SV=2 83 395 6.0E-72
sp|Q6LN87|LIPA_PHOPR Lipoyl synthase OS=Photobacterium profundum GN=lipA PE=3 SV=1 82 370 6.0E-72
sp|Q8P590|LIPA_XANCP Lipoyl synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lipA PE=3 SV=1 84 370 7.0E-72
sp|Q4UYT2|LIPA_XANC8 Lipoyl synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lipA PE=3 SV=1 84 370 7.0E-72
sp|Q1LSC9|LIPA_CUPMC Lipoyl synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lipA PE=3 SV=1 88 372 7.0E-72
sp|B8IDD6|LIPA_METNO Lipoyl synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=lipA PE=3 SV=1 84 374 7.0E-72
sp|Q7V507|LIPA1_PROMM Lipoyl synthase 1 OS=Prochlorococcus marinus (strain MIT 9313) GN=lipA1 PE=3 SV=1 88 373 8.0E-72
sp|B0RNP9|LIPA_XANCB Lipoyl synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=lipA PE=3 SV=1 84 370 8.0E-72
sp|Q9JZA5|LIPA_NEIMB Lipoyl synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=lipA PE=3 SV=1 88 384 8.0E-72
sp|A8FZ23|LIPA_SHESH Lipoyl synthase OS=Shewanella sediminis (strain HAW-EB3) GN=lipA PE=3 SV=1 80 370 1.0E-71
sp|Q214R4|LIPA_RHOPB Lipoyl synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=lipA PE=3 SV=1 88 374 1.0E-71
sp|B4RBV1|LIPA_PHEZH Lipoyl synthase OS=Phenylobacterium zucineum (strain HLK1) GN=lipA PE=3 SV=1 84 374 1.0E-71
sp|A9LZ95|LIPA_NEIM0 Lipoyl synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=lipA PE=3 SV=1 88 372 1.0E-71
sp|B1KDX3|LIPA_SHEWM Lipoyl synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lipA PE=3 SV=1 80 370 1.0E-71
sp|B0BRR9|LIPA_ACTPJ Lipoyl synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lipA PE=3 SV=1 88 370 1.0E-71
sp|B3H2J0|LIPA_ACTP7 Lipoyl synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lipA PE=3 SV=1 88 370 1.0E-71
sp|A3N2P1|LIPA_ACTP2 Lipoyl synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lipA PE=3 SV=1 88 370 1.0E-71
sp|Q7VKB1|LIPA_HAEDU Lipoyl synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lipA PE=3 SV=1 82 370 1.0E-71
sp|A9IS79|LIPA_BART1 Lipoyl synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=lipA PE=3 SV=1 83 386 1.0E-71
sp|Q92Q94|LIPA_RHIME Lipoyl synthase OS=Rhizobium meliloti (strain 1021) GN=lipA PE=3 SV=1 84 374 1.0E-71
sp|B8GMV6|LIPA_THISH Lipoyl synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=lipA PE=3 SV=1 86 372 1.0E-71
sp|Q57390|LIPA_PELCD Lipoyl synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lipA PE=3 SV=2 88 370 2.0E-71
sp|Q7MN17|LIPA_VIBVY Lipoyl synthase OS=Vibrio vulnificus (strain YJ016) GN=lipA PE=3 SV=1 80 370 2.0E-71
sp|Q8DFD1|LIPA_VIBVU Lipoyl synthase OS=Vibrio vulnificus (strain CMCP6) GN=lipA PE=3 SV=1 80 370 2.0E-71
sp|Q7V6S0|LIPA2_PROMM Lipoyl synthase 2 OS=Prochlorococcus marinus (strain MIT 9313) GN=lipA2 PE=3 SV=1 86 372 2.0E-71
sp|Q1I4G1|LIPA_PSEE4 Lipoyl synthase OS=Pseudomonas entomophila (strain L48) GN=lipA PE=3 SV=1 88 372 2.0E-71
sp|Q12QX1|LIPA_SHEDO Lipoyl synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lipA PE=3 SV=1 80 370 2.0E-71
sp|B1J144|LIPA_PSEPW Lipoyl synthase OS=Pseudomonas putida (strain W619) GN=lipA PE=3 SV=1 88 372 2.0E-71
sp|P73572|LIPA2_SYNY3 Lipoyl synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lipA2 PE=3 SV=1 86 372 2.0E-71
sp|Q6G166|LIPA_BARQU Lipoyl synthase OS=Bartonella quintana (strain Toulouse) GN=lipA PE=3 SV=1 83 386 3.0E-71
sp|Q3B3Y5|LIPA_CHLL7 Lipoyl synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lipA PE=3 SV=1 86 365 3.0E-71
sp|A1BFY3|LIPA_CHLPD Lipoyl synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=lipA PE=3 SV=1 83 370 3.0E-71
sp|B5EMR4|LIPA_ACIF5 Lipoyl synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lipA PE=3 SV=1 88 376 3.0E-71
sp|B7J7N7|LIPA_ACIF2 Lipoyl synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lipA PE=3 SV=1 88 376 3.0E-71
sp|B2AG37|LIPA_CUPTR Lipoyl synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=lipA PE=3 SV=1 88 372 3.0E-71
sp|Q477G5|LIPA_CUPPJ Lipoyl synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lipA PE=3 SV=1 88 372 3.0E-71
sp|Q88DM5|LIPA_PSEPK Lipoyl synthase OS=Pseudomonas putida (strain KT2440) GN=lipA PE=3 SV=1 88 372 4.0E-71
sp|A5W9I5|LIPA_PSEP1 Lipoyl synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lipA PE=3 SV=1 88 372 4.0E-71
sp|Q484R8|LIPA_COLP3 Lipoyl synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lipA PE=3 SV=1 81 370 4.0E-71
sp|Q3ARP5|LIPA_CHLCH Lipoyl synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=lipA PE=3 SV=2 84 378 4.0E-71
sp|Q8DL83|LIPA1_THEEB Lipoyl synthase 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=lipA1 PE=3 SV=2 88 382 5.0E-71
sp|B0UVP7|LIPA_HISS2 Lipoyl synthase OS=Histophilus somni (strain 2336) GN=lipA PE=3 SV=1 74 370 5.0E-71
sp|Q0I1H8|LIPA_HAES1 Lipoyl synthase OS=Haemophilus somnus (strain 129Pt) GN=lipA PE=3 SV=2 74 370 5.0E-71
sp|Q15VL3|LIPA_PSEA6 Lipoyl synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=lipA PE=3 SV=1 80 370 5.0E-71
sp|A9L014|LIPA_SHEB9 Lipoyl synthase OS=Shewanella baltica (strain OS195) GN=lipA PE=3 SV=1 80 370 5.0E-71
sp|A3D7P9|LIPA_SHEB5 Lipoyl synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=lipA PE=3 SV=1 80 370 5.0E-71
sp|B8E4W4|LIPA_SHEB2 Lipoyl synthase OS=Shewanella baltica (strain OS223) GN=lipA PE=3 SV=1 80 370 5.0E-71
sp|A7MY96|LIPA_VIBCB Lipoyl synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=lipA PE=3 SV=1 80 370 6.0E-71
sp|Q0APQ9|LIPA_MARMM Lipoyl synthase OS=Maricaulis maris (strain MCS10) GN=lipA PE=3 SV=1 77 374 6.0E-71
sp|C1DMR1|LIPA_AZOVD Lipoyl synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=lipA PE=3 SV=1 84 372 6.0E-71
sp|Q4QPL8|LIPA_HAEI8 Lipoyl synthase OS=Haemophilus influenzae (strain 86-028NP) GN=lipA PE=3 SV=1 74 370 6.0E-71
sp|Q4ZN84|LIPA_PSEU2 Lipoyl synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lipA PE=3 SV=1 88 372 7.0E-71
sp|Q48DM6|LIPA_PSE14 Lipoyl synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lipA PE=3 SV=1 88 372 7.0E-71
sp|Q87RR1|LIPA_VIBPA Lipoyl synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lipA PE=3 SV=1 80 370 7.0E-71
sp|P44463|LIPA_HAEIN Lipoyl synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lipA PE=3 SV=1 74 370 7.0E-71
sp|Q4FM35|LIPA_PELUB Lipoyl synthase OS=Pelagibacter ubique (strain HTCC1062) GN=lipA PE=3 SV=1 84 374 8.0E-71
sp|Q9KTF9|LIPA_VIBCH Lipoyl synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lipA PE=3 SV=1 80 370 8.0E-71
sp|C3LTJ1|LIPA_VIBCM Lipoyl synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=lipA PE=3 SV=1 80 370 8.0E-71
sp|A5F2Y0|LIPA_VIBC3 Lipoyl synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=lipA PE=3 SV=1 80 370 8.0E-71
sp|A1RGT2|LIPA_SHESW Lipoyl synthase OS=Shewanella sp. (strain W3-18-1) GN=lipA PE=3 SV=1 80 370 9.0E-71
sp|A4Y9G2|LIPA_SHEPC Lipoyl synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lipA PE=3 SV=1 80 370 9.0E-71
sp|Q0HLK3|LIPA_SHESM Lipoyl synthase OS=Shewanella sp. (strain MR-4) GN=lipA PE=3 SV=1 80 370 9.0E-71
sp|A0KTV4|LIPA_SHESA Lipoyl synthase OS=Shewanella sp. (strain ANA-3) GN=lipA PE=3 SV=1 80 370 9.0E-71
sp|P61199|LIPA_TREDE Lipoyl synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lipA PE=3 SV=1 86 370 9.0E-71
sp|Q98MY2|LIPA_RHILO Lipoyl synthase OS=Rhizobium loti (strain MAFF303099) GN=lipA PE=3 SV=1 84 374 1.0E-70
sp|Q0HXV7|LIPA_SHESR Lipoyl synthase OS=Shewanella sp. (strain MR-7) GN=lipA PE=3 SV=1 80 370 1.0E-70
sp|A6V0B4|LIPA_PSEA7 Lipoyl synthase OS=Pseudomonas aeruginosa (strain PA7) GN=lipA PE=3 SV=2 88 372 1.0E-70
sp|A1K1U7|LIPA_AZOSB Lipoyl synthase OS=Azoarcus sp. (strain BH72) GN=lipA PE=3 SV=1 88 372 1.0E-70
sp|Q9HX25|LIPA_PSEAE Lipoyl synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lipA PE=3 SV=1 88 372 2.0E-70
sp|Q02SG3|LIPA_PSEAB Lipoyl synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lipA PE=3 SV=1 88 372 2.0E-70
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0051540 metal cluster binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1500
MAAPSLASSLHRAHAPARRILTATHAFATVPTPKDPPTRPKSYFKDTTLASFSEFVTSSQPLPTSEAYALRTAQV
GPNGKKRTITRLPEWLKTPMPATGNENLKKIRADLRGLGLHTVCEEARCPNISECWGGSDKSAATATIMLMGDTC
TRGCRFCSVKTSRTPPPLDAHEPENTAEALARWGLGYVVLTSVDRDDLPDGGSRHFAETISKIKHKKPSLLVEAL
TGDFRGDLEQVRVVAESGLDVYAHNVETVEDLTPYVRDRRATFRQSLNVLAHVKEVRGKDKIVTKTSIMLGLGEQ
EREVVDALTELRRANVDVVTFGQYMRPTKRHLKVEKYITPDEFESWRKRALDMGFLYCASGPLVRSSYKAGEAFI
ENVLRKRAGEKNVAPRSSLGEAAALESDART*
Coding >OphauB2|1500
ATGGCTGCACCCTCTCTCGCCTCGTCGCTTCACCGCGCCCACGCTCCCGCCCGACGAATCCTCACCGCCACCCAC
GCCTTTGCCACAGTCCCCACGCCCAAGGACCCCCCCACGCGGCCCAAATCCTACTTCAAAGACACCACCCTGGCC
TCTTTTTCCGAGTTTGTCACCTCGTCGCAGCCGCTGCCCACGTCGGAAGCCTACGCCCTGCGCACCGCACAAGTA
GGCCCCAACGGCAAGAAGCGCACCATTACGCGCCTCCCCGAATGGCTAAAGACGCCCATGCCCGCCACCGGCAAT
GAAAACTTGAAAAAGATTCGCGCCGACCTGCGCGGCCTGGGCCTCCACACCGTGTGCGAAGAGGCGCGCTGTCCA
AACATCTCCGAGTGCTGGGGCGGCTCCGACAAGAGCGCCGCCACGGCAACCATTATGCTCATGGGCGATACGTGT
ACGCGCGGATGCCGCTTCTGCAGCGTAAAGACGAGCCGAACCCCGCCGCCCCTCGATGCTCACGAGCCGGAGAAT
ACGGCAGAGGCGCTGGCGCGATGGGGCCTGGGCTACGTGGTGCTTACCAGCGTGGACCGCGATGACTTGCCAGAT
GGGGGGTCGCGACACTTTGCAGAGACGATTAGCAAGATTAAGCACAAGAAGCCCTCCCTCTTGGTCGAGGCGCTG
ACTGGCGACTTTCGCGGCGACTTGGAGCAGGTGCGCGTTGTGGCGGAGAGTGGCCTCGACGTGTATGCTCACAAT
GTCGAGACGGTCGAGGACCTGACGCCCTATGTGCGTGATCGCCGGGCAACCTTTCGCCAGAGCCTCAATGTGCTG
GCGCACGTTAAAGAGGTTCGCGGCAAGGACAAGATTGTCACCAAGACGAGCATCATGCTTGGCCTCGGCGAACAA
GAGCGCGAGGTTGTCGATGCGCTTACAGAATTGAGAAGAGCCAATGTCGACGTCGTCACCTTTGGCCAATACATG
CGCCCTACCAAGCGCCACCTCAAGGTGGAAAAATACATTACGCCCGACGAATTCGAATCGTGGCGCAAACGAGCT
CTCGACATGGGCTTCCTCTACTGCGCCAGCGGGCCCCTTGTCCGCTCCTCATACAAGGCTGGCGAGGCCTTTATC
GAAAACGTGCTGCGCAAGCGCGCCGGCGAGAAGAATGTGGCGCCGCGGTCTAGTCTGGGTGAAGCTGCGGCTCTC
GAGTCGGATGCGAGGACATAG
Transcript >OphauB2|1500
ATGGCTGCACCCTCTCTCGCCTCGTCGCTTCACCGCGCCCACGCTCCCGCCCGACGAATCCTCACCGCCACCCAC
GCCTTTGCCACAGTCCCCACGCCCAAGGACCCCCCCACGCGGCCCAAATCCTACTTCAAAGACACCACCCTGGCC
TCTTTTTCCGAGTTTGTCACCTCGTCGCAGCCGCTGCCCACGTCGGAAGCCTACGCCCTGCGCACCGCACAAGTA
GGCCCCAACGGCAAGAAGCGCACCATTACGCGCCTCCCCGAATGGCTAAAGACGCCCATGCCCGCCACCGGCAAT
GAAAACTTGAAAAAGATTCGCGCCGACCTGCGCGGCCTGGGCCTCCACACCGTGTGCGAAGAGGCGCGCTGTCCA
AACATCTCCGAGTGCTGGGGCGGCTCCGACAAGAGCGCCGCCACGGCAACCATTATGCTCATGGGCGATACGTGT
ACGCGCGGATGCCGCTTCTGCAGCGTAAAGACGAGCCGAACCCCGCCGCCCCTCGATGCTCACGAGCCGGAGAAT
ACGGCAGAGGCGCTGGCGCGATGGGGCCTGGGCTACGTGGTGCTTACCAGCGTGGACCGCGATGACTTGCCAGAT
GGGGGGTCGCGACACTTTGCAGAGACGATTAGCAAGATTAAGCACAAGAAGCCCTCCCTCTTGGTCGAGGCGCTG
ACTGGCGACTTTCGCGGCGACTTGGAGCAGGTGCGCGTTGTGGCGGAGAGTGGCCTCGACGTGTATGCTCACAAT
GTCGAGACGGTCGAGGACCTGACGCCCTATGTGCGTGATCGCCGGGCAACCTTTCGCCAGAGCCTCAATGTGCTG
GCGCACGTTAAAGAGGTTCGCGGCAAGGACAAGATTGTCACCAAGACGAGCATCATGCTTGGCCTCGGCGAACAA
GAGCGCGAGGTTGTCGATGCGCTTACAGAATTGAGAAGAGCCAATGTCGACGTCGTCACCTTTGGCCAATACATG
CGCCCTACCAAGCGCCACCTCAAGGTGGAAAAATACATTACGCCCGACGAATTCGAATCGTGGCGCAAACGAGCT
CTCGACATGGGCTTCCTCTACTGCGCCAGCGGGCCCCTTGTCCGCTCCTCATACAAGGCTGGCGAGGCCTTTATC
GAAAACGTGCTGCGCAAGCGCGCCGGCGAGAAGAATGTGGCGCCGCGGTCTAGTCTGGGTGAAGCTGCGGCTCTC
GAGTCGGATGCGAGGACATAG
Gene >OphauB2|1500
ATGGCTGCACCCTCTCTCGCCTCGTCGCTTCACCGCGCCCACGCTCCCGCCCGACGAATCCTCACCGCCACCCAC
GCCTTTGCCACAGTCCCCACGCCCAAGGACCCCCCCACGCGGCCCAAATCCTACTTCAAAGACACCACCCTGGCC
TCTTTTTCCGAGTTTGTCACCTCGTCGCAGCCGCTGCCCACGTCGGAAGCCTACGCCCTGCGCACCGCACAAGTA
GGCCCCAACGGCAAGAAGCGCACCATTACGCGCCTCCCCGAATGGCTAAAGACGCCCATGCCCGCCACCGGCAAT
GAAAACTTGAAAAAGATTCGCGCCGACCTGCGCGGCCTGGGCCTCCACACCGTGTGCGAAGAGGCGCGCTGTCCA
AACATCTCCGAGTGCTGGGGCGGCTCCGACAAGAGCGCCGCCACGGCAACCATTATGCTCATGGGCGATACGTGT
ACGCGCGGATGCCGCTTCTGCAGCGTAAAGACGAGCCGAACCCCGCCGCCCCTCGATGCTCACGAGCCGGAGAAT
ACGGCAGAGGCGCTGGCGCGATGGGGCCTGGGCTACGTGGTGCTTACCAGCGTGGACCGCGATGACTTGCCAGAT
GGGGGGTCGCGACACTTTGCAGAGACGATTAGCAAGATTAAGCACAAGAAGCCCTCCCTCTTGGTCGAGGCGCTG
ACTGGCGACTTTCGCGGCGACTTGGAGCAGGTGCGCGTTGTGGCGGAGAGTGGCCTCGACGTGTATGCTCACAAT
GTCGAGACGGTCGAGGACCTGACGCCCTATGTGCGTGATCGCCGGGCAACCTTTCGCCAGAGCCTCAATGTGCTG
GCGCACGTTAAAGAGGTTCGCGGCAAGGACAAGATTGTCACCAAGACGAGCATCATGCTTGGCCTCGGCGAACAA
GAGCGCGAGGTTGTCGATGCGCTTACAGGCAAGTGTTTTTTTTTTTACACTTCTTTTTTGGTGCCCATTGAGCAT
CTACTCTCTTCTTGCTTGTAACGGTTGAGTCTAACAGCCTCTGCAACAGAATTGAGAAGAGCCAATGTCGACGTC
GTCACCTTTGGCCAATACATGCGCCCTACCAAGCGCCACCTCAAGGTGGAAAAATACATTACGCCCGACGAATTC
GAATCGTGGCGCAAACGAGCTCTCGACATGGGCTTCCTCTACTGCGCCAGCGGGCCCCTTGTCCGCTCCTCATAC
AAGGCTGGCGAGGCCTTTATCGAAAACGTGCTGCGCAAGCGCGCCGGCGAGAAGAATGTGGCGCCGCGGTCTAGT
CTGGGTGAAGCTGCGGCTCTCGAGTCGGATGCGAGGACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail