Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|150
Gene name
LocationContig_1:383004..383584
Strand-
Gene length (bp)580
Transcript length (bp)435
Coding sequence length (bp)435
Protein length (aa) 145

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10639 TMEM234 Putative transmembrane family 234 1.8E-34 15 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54ZG7|TM234_DICDI Transmembrane protein 234 homolog OS=Dictyostelium discoideum GN=DDB_G0277575 PE=3 SV=1 12 143 6.0E-20
sp|A0NGI1|TM234_ANOGA Transmembrane protein 234 homolog OS=Anopheles gambiae GN=AGAP012180 PE=3 SV=1 12 143 7.0E-12
sp|A7YW81|TM234_BOVIN Transmembrane protein 234 OS=Bos taurus GN=TMEM234 PE=2 SV=1 22 142 1.0E-11
sp|Q8R1E7|TM234_MOUSE Transmembrane protein 234 OS=Mus musculus GN=Tmem234 PE=1 SV=1 22 142 3.0E-11
sp|Q8WY98|TM234_HUMAN Transmembrane protein 234 OS=Homo sapiens GN=TMEM234 PE=1 SV=1 22 142 8.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54ZG7|TM234_DICDI Transmembrane protein 234 homolog OS=Dictyostelium discoideum GN=DDB_G0277575 PE=3 SV=1 12 143 6.0E-20
sp|A0NGI1|TM234_ANOGA Transmembrane protein 234 homolog OS=Anopheles gambiae GN=AGAP012180 PE=3 SV=1 12 143 7.0E-12
sp|A7YW81|TM234_BOVIN Transmembrane protein 234 OS=Bos taurus GN=TMEM234 PE=2 SV=1 22 142 1.0E-11
sp|Q8R1E7|TM234_MOUSE Transmembrane protein 234 OS=Mus musculus GN=Tmem234 PE=1 SV=1 22 142 3.0E-11
sp|Q8WY98|TM234_HUMAN Transmembrane protein 234 OS=Homo sapiens GN=TMEM234 PE=1 SV=1 22 142 8.0E-10
sp|Q5RBQ9|TM234_PONAB Transmembrane protein 234 OS=Pongo abelii GN=TMEM234 PE=2 SV=1 22 142 1.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 70 89 19
3 94 116 22
4 120 142 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|150
MAADRPPVINYVLSFVLVGLAWGLTTPFIRRAAREAPAAEAEAETEASSGLRLRIKKRCKAAIDLLRRPAYLIPL
LLNLTGSVWFFLLIGQAELSLTVPIVNTLAFLFTVLGEWYVEGKVISKSTGLGMLLSLSGIALCVYSKT*
Coding >OphauB2|150
ATGGCTGCTGACCGCCCCCCCGTCATTAATTACGTCTTGTCCTTTGTTCTTGTCGGGCTTGCATGGGGTCTCACG
ACCCCTTTTATCCGGCGGGCGGCCCGAGAAGCACCAGCAGCCGAGGCCGAGGCAGAGACGGAGGCGAGCTCTGGA
CTGCGACTGCGCATAAAAAAGCGGTGCAAGGCGGCCATTGATCTGCTTCGCAGACCAGCATATCTCATACCGCTA
CTGCTCAACTTAACGGGTAGCGTGTGGTTTTTTCTCCTCATCGGCCAGGCGGAGCTCAGTCTTACTGTGCCCATT
GTCAACACTCTTGCCTTTCTCTTCACCGTATTGGGCGAGTGGTATGTTGAGGGCAAAGTGATTAGCAAATCCACG
GGTCTTGGCATGTTGCTTTCACTGAGTGGTATTGCTTTATGTGTCTATAGCAAGACTTGA
Transcript >OphauB2|150
ATGGCTGCTGACCGCCCCCCCGTCATTAATTACGTCTTGTCCTTTGTTCTTGTCGGGCTTGCATGGGGTCTCACG
ACCCCTTTTATCCGGCGGGCGGCCCGAGAAGCACCAGCAGCCGAGGCCGAGGCAGAGACGGAGGCGAGCTCTGGA
CTGCGACTGCGCATAAAAAAGCGGTGCAAGGCGGCCATTGATCTGCTTCGCAGACCAGCATATCTCATACCGCTA
CTGCTCAACTTAACGGGTAGCGTGTGGTTTTTTCTCCTCATCGGCCAGGCGGAGCTCAGTCTTACTGTGCCCATT
GTCAACACTCTTGCCTTTCTCTTCACCGTATTGGGCGAGTGGTATGTTGAGGGCAAAGTGATTAGCAAATCCACG
GGTCTTGGCATGTTGCTTTCACTGAGTGGTATTGCTTTATGTGTCTATAGCAAGACTTGA
Gene >OphauB2|150
ATGGCTGCTGACCGCCCCCCCGTCATTAATTACGTCTTGTCCTTTGTTCTTGTCGGGCTTGCATGGGGTCTCACG
ACCCCTTTTATCCGGCGGGCGGCCCGAGAAGCACCAGCAGCCGAGGCCGAGGCAGAGACGGAGGCGAGCTCTGGA
CTGCGACTGCGCATAAAAAAGCGGTGCAAGGCGGCCATTGATCTGCTTCGCAGACCAGCATATCTCATACCGCTA
CTGCTCAACTTAACGGGTAGCGTGTGGTTTTTTCTCCTCATCGGCCAGGCGGGTGAGTGGCGCTCTATGGTGGCT
GAGTCTGGCAAATTATCCAAGTGTTGGTATAGTGATATAGACTTGGCTGACGGATTCATTTAGAGCTCAGTCTTA
CTGTGCCCATTGTCAACACTCTTGCCTTTCTCTTCACCGTATTGGGCGAGTGGTATGTTGAGGGCAAAGTGATTA
GCAAATGTGCGTTCCCTTGGCTCCTTACTTGGCTTCGCCGTCTCACTGACTGTGCATCTTCAAAGCCACGGGTCT
TGGCATGTTGCTTTCACTGAGTGGTATTGCTTTATGTGTCTATAGCAAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail