Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1494
Gene name
LocationContig_14:132482..134001
Strand-
Gene length (bp)1519
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 7.1E-46 76 417

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96QU6|1A1L1_HUMAN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Homo sapiens GN=ACCS PE=1 SV=1 28 428 3.0E-52
sp|Q9W698|1A1L1_TAKRU 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Takifugu rubripes GN=accs PE=3 SV=1 28 426 1.0E-51
sp|Q5E9H2|1A1L1_BOVIN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Bos taurus GN=ACCS PE=2 SV=1 28 428 1.0E-50
sp|P31531|1A1C_SOYBN 1-aminocyclopropane-1-carboxylate synthase OS=Glycine max GN=ACS1 PE=2 SV=1 20 427 3.0E-50
sp|A2AIG8|1A1L1_MOUSE 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Mus musculus GN=Accs PE=2 SV=1 28 428 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96QU6|1A1L1_HUMAN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Homo sapiens GN=ACCS PE=1 SV=1 28 428 3.0E-52
sp|Q9W698|1A1L1_TAKRU 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Takifugu rubripes GN=accs PE=3 SV=1 28 426 1.0E-51
sp|Q5E9H2|1A1L1_BOVIN 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Bos taurus GN=ACCS PE=2 SV=1 28 428 1.0E-50
sp|P31531|1A1C_SOYBN 1-aminocyclopropane-1-carboxylate synthase OS=Glycine max GN=ACS1 PE=2 SV=1 20 427 3.0E-50
sp|A2AIG8|1A1L1_MOUSE 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Mus musculus GN=Accs PE=2 SV=1 28 428 2.0E-49
sp|Q00257|1A12_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima GN=ACS2 PE=2 SV=1 18 423 2.0E-49
sp|Q9MB95|1A11_PRUMU 1-aminocyclopropane-1-carboxylate synthase 1 OS=Prunus mume GN=ACS1 PE=2 SV=1 20 424 3.0E-49
sp|Q9SAR0|1A16_ARATH 1-aminocyclopropane-1-carboxylate synthase 6 OS=Arabidopsis thaliana GN=ACS6 PE=1 SV=2 20 426 7.0E-48
sp|Q07262|1A1C_TOBAC 1-aminocyclopropane-1-carboxylate synthase OS=Nicotiana tabacum GN=ACS1 PE=2 SV=1 20 421 2.0E-47
sp|Q10DK7|1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=2 SV=1 5 428 2.0E-47
sp|A2XLL2|1A11_ORYSI 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica GN=ACC1 PE=2 SV=2 5 428 2.0E-47
sp|Q42881|1A13_SOLLC 1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1 18 421 3.0E-47
sp|P18485|1A12_SOLLC 1-aminocyclopropane-1-carboxylate synthase 2 OS=Solanum lycopersicum GN=ACS2 PE=1 SV=2 20 416 3.0E-47
sp|Q43309|1A14_ARATH 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana GN=ACS4 PE=1 SV=1 9 421 2.0E-46
sp|Q9S9U6|1A111_ARATH 1-aminocyclopropane-1-carboxylate synthase 11 OS=Arabidopsis thaliana GN=ACS11 PE=1 SV=1 18 421 3.0E-46
sp|Q06429|1A11_ARATH 1-aminocyclopropane-1-carboxylate synthase-like protein 1 OS=Arabidopsis thaliana GN=ACS1 PE=1 SV=2 20 421 4.0E-46
sp|Q9T065|1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1 20 403 6.0E-46
sp|Q3UX83|1A1L2_MOUSE Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Mus musculus GN=Accsl PE=2 SV=1 5 405 1.0E-45
sp|P37821|1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica GN=ACS-1 PE=1 SV=2 18 427 8.0E-45
sp|P29535|1A14_SOLLC 1-aminocyclopropane-1-carboxylate synthase 4 OS=Solanum lycopersicum GN=ACS4 PE=2 SV=1 20 427 2.0E-44
sp|Q37001|1A15_ARATH 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana GN=ACS5 PE=1 SV=1 18 425 2.0E-44
sp|Q8GYY0|1A112_ARATH Probable aminotransferase ACS12 OS=Arabidopsis thaliana GN=ACS12 PE=2 SV=2 28 417 5.0E-44
sp|Q9LQ10|1A110_ARATH Probable aminotransferase ACS10 OS=Arabidopsis thaliana GN=ACS10 PE=1 SV=1 28 417 6.0E-44
sp|Q9M2Y8|1A19_ARATH 1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana GN=ACS9 PE=1 SV=1 18 425 2.0E-43
sp|Q4AC99|1A1L2_HUMAN Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2 OS=Homo sapiens GN=ACCSL PE=2 SV=3 28 426 3.0E-43
sp|Q06402|1A12_ARATH 1-aminocyclopropane-1-carboxylate synthase 2 OS=Arabidopsis thaliana GN=ACS2 PE=1 SV=1 20 423 2.0E-42
sp|Q9STR4|1A17_ARATH 1-aminocyclopropane-1-carboxylate synthase 7 OS=Arabidopsis thaliana GN=ACS7 PE=1 SV=1 20 417 4.0E-42
sp|P23599|1A11_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMW33 OS=Cucurbita maxima GN=ACS1 PE=2 SV=1 20 425 7.0E-42
sp|P27486|1A1C_DIACA 1-aminocyclopropane-1-carboxylate synthase OS=Dianthus caryophyllus GN=ACS2 PE=2 SV=1 20 424 1.0E-41
sp|Q00379|1A12_CUCPE 1-aminocyclopropane-1-carboxylate synthase 2 OS=Cucurbita pepo GN=ACS2 PE=2 SV=1 20 425 3.0E-41
sp|Q01912|1A1C_VIGRR 1-aminocyclopropane-1-carboxylate synthase (Fragment) OS=Vigna radiata var. radiata GN=ACS5 PE=2 SV=1 100 403 5.0E-41
sp|P23279|1A11_CUCPE 1-aminocyclopropane-1-carboxylate synthase 1 OS=Cucurbita pepo GN=ACC1A PE=1 SV=1 20 425 1.0E-40
sp|O33822|AAT_THEAQ Aspartate aminotransferase OS=Thermus aquaticus GN=aspC PE=3 SV=1 182 421 2.0E-14
sp|Q56232|AAT_THET8 Aspartate aminotransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=aspC PE=1 SV=1 182 424 4.0E-14
sp|O67781|AAT_AQUAE Aspartate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=aspC PE=3 SV=1 37 423 1.0E-12
sp|Q795M6|YUGH_BACSU Putative aminotransferase YugH OS=Bacillus subtilis (strain 168) GN=yugH PE=3 SV=1 35 423 6.0E-12
sp|Q08432|CBL_BACSU Cystathionine beta-lyase PatB OS=Bacillus subtilis (strain 168) GN=patB PE=1 SV=1 180 422 6.0E-12
sp|Q9HUI9|ARUH_PSEAE Arginine--pyruvate transaminase AruH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruH PE=1 SV=1 119 275 1.0E-10
sp|Q9LR30|GGT1_ARATH Glutamate--glyoxylate aminotransferase 1 OS=Arabidopsis thaliana GN=GGAT1 PE=1 SV=1 106 240 1.0E-10
sp|Q9X0Y2|AAT_THEMA Aspartate aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aspC PE=1 SV=1 97 418 2.0E-10
sp|P47039|BNA3_YEAST Probable kynurenine--oxoglutarate transaminase BNA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA3 PE=1 SV=1 87 363 2.0E-10
sp|Q54K95|ATTY_DICDI Tyrosine aminotransferase OS=Dictyostelium discoideum GN=tat PE=3 SV=1 93 417 2.0E-10
sp|Q9S7E9|GGT2_ARATH Glutamate--glyoxylate aminotransferase 2 OS=Arabidopsis thaliana GN=GGAT2 PE=1 SV=1 106 246 7.0E-10
sp|Q58097|MFNC_METJA (5-formylfuran-3-yl)methyl phosphate transaminase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=mfnC PE=1 SV=2 97 423 4.0E-09
sp|P52894|ALA2_HORVU Alanine aminotransferase 2 OS=Hordeum vulgare PE=1 SV=1 96 227 6.0E-09
sp|Q972A2|AAT_SULTO Aspartate aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspC PE=3 SV=1 182 421 6.0E-09
sp|Q2NEQ0|HIS8_METST Histidinol-phosphate aminotransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisC PE=3 SV=1 78 386 7.0E-09
sp|Q60317|AAT_METJA Probable aspartate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0001 PE=3 SV=1 100 272 1.0E-08
sp|Q9LDV4|ALAT2_ARATH Alanine aminotransferase 2, mitochondrial OS=Arabidopsis thaliana GN=ALAAT2 PE=2 SV=1 96 227 4.0E-08
sp|P34106|ALA2_PANMI Alanine aminotransferase 2 OS=Panicum miliaceum PE=1 SV=1 96 227 5.0E-08
sp|Q60013|AAT_STRVG Aspartate aminotransferase OS=Streptomyces virginiae GN=aspC PE=3 SV=1 37 424 7.0E-08
sp|B8I5V1|HIS8_CLOCE Histidinol-phosphate aminotransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hisC PE=3 SV=1 79 279 8.0E-08
sp|Q54MJ7|ALAM_DICDI Probable alanine aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=gpt PE=3 SV=1 106 272 1.0E-07
sp|F4I7I0|ALAT1_ARATH Alanine aminotransferase 1, mitochondrial OS=Arabidopsis thaliana GN=ALAAT1 PE=1 SV=1 96 227 1.0E-07
sp|Q9V0L2|AAT_PYRAB Aspartate aminotransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspC PE=3 SV=1 153 339 1.0E-07
sp|P9WQ91|AAT_MYCTU Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aspC PE=1 SV=1 100 272 2.0E-07
sp|P9WQ90|AAT_MYCTO Probable aspartate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aspC PE=3 SV=1 100 272 2.0E-07
sp|P63499|AAT_MYCBO Probable aspartate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aspC PE=3 SV=1 100 272 2.0E-07
sp|A5N7Q7|HIS8_CLOK5 Histidinol-phosphate aminotransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=hisC PE=3 SV=1 78 322 6.0E-07
sp|B9E168|HIS8_CLOK1 Histidinol-phosphate aminotransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=hisC PE=3 SV=1 78 322 6.0E-07
sp|P23034|AAT_BACY2 Aspartate aminotransferase OS=Bacillus sp. (strain YM-2) PE=1 SV=1 53 417 7.0E-07
sp|Q9FN30|TAT2_ARATH Probable aminotransferase TAT2 OS=Arabidopsis thaliana GN=At5g53970 PE=2 SV=1 64 418 9.0E-07
sp|P33447|ATTY_TRYCR Tyrosine aminotransferase OS=Trypanosoma cruzi PE=1 SV=2 46 275 1.0E-06
sp|Q28DB5|ALAT2_XENTR Alanine aminotransferase 2 OS=Xenopus tropicalis GN=gpt2 PE=2 SV=1 107 289 1.0E-06
sp|H3ZPU1|ARAT2_THELN Aromatic-amino-acid aminotransferase 2 OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=OCC_04737 PE=1 SV=1 153 311 2.0E-06
sp|Q5F4K8|PAT_PINPS Aspartate aminotransferase OS=Pinus pinaster GN=AAT PE=1 SV=1 182 420 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0070279 vitamin B6 binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:1901363 heterocyclic compound binding No
GO:0019842 vitamin binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1494
MESYLSKRSAATIAKQHLPWRFAPSQTYHRLTNPQGLISFGTAENKLVTGDVENFVNSAVKFESQQFTYGFSHAG
GPRFPAALAVHLNEYLKPHEPIVADNIKVTGSATPMHEILAWGLADAGDGILTSRPVYGRFELDFGNRANVNVVY
ADTHAENCFQEDVVDKFEEALLTSEQHGVSIKALLIVNPHNPLGRCYPRETLIALMKFCQKHQLHLISDEIYACS
IFDSGETDPTPFTSALAIDTDGLIDTERLHVTYGFSKDFGTAGLRIGAIITRSKAVESAITPVLRFHNPAGPSLA
IGAAMLEDRKWCREFVESSRQKLAAAYRHATQGLRAIGIDYLPGSNAGFFVWMDLSPYLPTEDELGDESCPEFAL
AKRLRDCGVFLHPREEHCLNPGWFRMVYTQDPDIVTEGIRRIKSAISKADDVA*
Coding >OphauB2|1494
ATGGAATCATACTTGTCCAAGCGCAGCGCCGCCACCATCGCCAAGCAGCATCTGCCCTGGAGGTTTGCGCCTTCG
CAAACCTACCATCGCCTCACCAACCCACAAGGCCTCATCTCGTTTGGCACAGCTGAGAATAAACTCGTGACTGGA
GACGTTGAGAACTTCGTCAACAGCGCTGTCAAGTTTGAATCACAGCAGTTCACCTATGGCTTCTCCCATGCCGGC
GGGCCGCGCTTCCCTGCCGCCCTTGCCGTCCACCTCAACGAGTATCTCAAACCCCATGAGCCCATCGTTGCCGAT
AACATCAAGGTGACTGGCTCAGCCACCCCTATGCATGAGATACTTGCCTGGGGTCTGGCAGATGCTGGTGACGGC
ATCTTGACGAGCCGTCCCGTCTATGGCCGCTTTGAGCTAGATTTCGGAAACCGTGCAAATGTCAATGTCGTCTAT
GCAGACACGCATGCCGAGAATTGCTTCCAAGAGGACGTGGTAGACAAGTTTGAAGAAGCCCTTTTGACATCGGAG
CAGCATGGCGTGAGTATCAAGGCTCTTCTCATTGTCAATCCTCATAATCCACTGGGCAGGTGTTATCCTCGAGAG
ACGCTCATTGCCCTCATGAAGTTTTGTCAAAAACACCAATTGCATCTCATTAGCGATGAGATATACGCTTGCTCC
ATATTTGATTCTGGAGAGACAGACCCGACGCCCTTTACCTCTGCCCTAGCCATTGATACCGATGGACTCATTGAC
ACGGAGCGACTTCACGTCACCTATGGCTTTAGCAAAGACTTTGGGACGGCCGGCCTGCGCATTGGTGCCATCATC
ACGCGTAGCAAGGCCGTCGAGTCGGCCATTACGCCAGTCTTACGCTTCCACAATCCCGCGGGGCCGAGCCTAGCT
ATTGGCGCCGCCATGCTTGAGGACCGCAAGTGGTGTCGAGAATTTGTCGAGTCATCGCGCCAAAAGCTGGCAGCA
GCTTACCGTCATGCAACCCAGGGTCTGCGAGCCATTGGCATTGACTATCTGCCCGGCAGTAACGCCGGCTTCTTT
GTCTGGATGGATCTATCGCCGTATTTGCCCACCGAGGACGAGTTGGGCGATGAGTCGTGCCCCGAGTTTGCCCTG
GCAAAGAGATTACGCGATTGTGGCGTCTTTCTTCATCCCCGAGAGGAACATTGCCTCAACCCTGGATGGTTTCGC
ATGGTTTATACTCAGGATCCAGACATTGTGACTGAGGGCATCAGACGCATCAAGTCGGCAATATCCAAAGCGGAC
GATGTGGCGTGA
Transcript >OphauB2|1494
ATGGAATCATACTTGTCCAAGCGCAGCGCCGCCACCATCGCCAAGCAGCATCTGCCCTGGAGGTTTGCGCCTTCG
CAAACCTACCATCGCCTCACCAACCCACAAGGCCTCATCTCGTTTGGCACAGCTGAGAATAAACTCGTGACTGGA
GACGTTGAGAACTTCGTCAACAGCGCTGTCAAGTTTGAATCACAGCAGTTCACCTATGGCTTCTCCCATGCCGGC
GGGCCGCGCTTCCCTGCCGCCCTTGCCGTCCACCTCAACGAGTATCTCAAACCCCATGAGCCCATCGTTGCCGAT
AACATCAAGGTGACTGGCTCAGCCACCCCTATGCATGAGATACTTGCCTGGGGTCTGGCAGATGCTGGTGACGGC
ATCTTGACGAGCCGTCCCGTCTATGGCCGCTTTGAGCTAGATTTCGGAAACCGTGCAAATGTCAATGTCGTCTAT
GCAGACACGCATGCCGAGAATTGCTTCCAAGAGGACGTGGTAGACAAGTTTGAAGAAGCCCTTTTGACATCGGAG
CAGCATGGCGTGAGTATCAAGGCTCTTCTCATTGTCAATCCTCATAATCCACTGGGCAGGTGTTATCCTCGAGAG
ACGCTCATTGCCCTCATGAAGTTTTGTCAAAAACACCAATTGCATCTCATTAGCGATGAGATATACGCTTGCTCC
ATATTTGATTCTGGAGAGACAGACCCGACGCCCTTTACCTCTGCCCTAGCCATTGATACCGATGGACTCATTGAC
ACGGAGCGACTTCACGTCACCTATGGCTTTAGCAAAGACTTTGGGACGGCCGGCCTGCGCATTGGTGCCATCATC
ACGCGTAGCAAGGCCGTCGAGTCGGCCATTACGCCAGTCTTACGCTTCCACAATCCCGCGGGGCCGAGCCTAGCT
ATTGGCGCCGCCATGCTTGAGGACCGCAAGTGGTGTCGAGAATTTGTCGAGTCATCGCGCCAAAAGCTGGCAGCA
GCTTACCGTCATGCAACCCAGGGTCTGCGAGCCATTGGCATTGACTATCTGCCCGGCAGTAACGCCGGCTTCTTT
GTCTGGATGGATCTATCGCCGTATTTGCCCACCGAGGACGAGTTGGGCGATGAGTCGTGCCCCGAGTTTGCCCTG
GCAAAGAGATTACGCGATTGTGGCGTCTTTCTTCATCCCCGAGAGGAACATTGCCTCAACCCTGGATGGTTTCGC
ATGGTTTATACTCAGGATCCAGACATTGTGACTGAGGGCATCAGACGCATCAAGTCGGCAATATCCAAAGCGGAC
GATGTGGCGTGA
Gene >OphauB2|1494
ATGGAATCATACTTGTCCAAGCGCAGCGCCGCCACCATCGCCAAGCAGCATCTGCCCTGGAGGTTTGCGCCTTCG
CAAACCTACCATCGCCTCACCAACCCACAAGGCCTCATCTCGTTTGGCACAGCTGAGAATGTATGACAGTGTGGC
CTCGTGCGGCGTGGCAGCAATGGCTCATGTACCCTAGAAACTCGTGACTGGAGACGTTGAGAACTTCGTCAACAG
CGCTGTGAGACATGCCTCAACACCAACATCCCTTGCTTGTCAAGCTCACCATGGCTAGGTCAAGTTTGAATCACA
GCAGTTCACCTATGGCTTCTCCCATGCCGGCGGGCCGCGCTTCCCTGCCGCCCTTGCCGTCCACCTCAACGAGTA
TCTCAAACCCCATGAGCCCATCGTTGCCGATAACATCAAGGTGACTGGCTCAGCCACCCCTATGCATGAGATACT
TGCCTGGGGTCTGGCAGATGCTGGTGACGGCATCTTGACGAGCCGTCCCGTCTATGGCCGCTTTGAGCTAGATTT
CGGAAACCGTGCAAATGTCAATGTCGTCTATGCAGACACGCATGCCGAGAATTGCTTCCAAGAGGACGTGGTAGA
CAAGTTTGAAGAAGCCCTTTTGACATCGGAGCAGCATGGCGTGAGTATCAAGGCTCTTCTCATTGTCAATCCTCA
TAATCCACTGGGTCAGTTTTGAGCCATCATTTGTTCTTGGTGGGGCCCATGCAGCCTAACTCATCTCCCTGTAGG
CAGGTGTTATCCTCGAGAGACGCTCATTGCCCTCATGAAGTTTTGTCAAAAACACCAATTGCATCTCATTAGCGA
TGAGATATACGCTTGCTCCATATTTGATTCTGGAGAGACAGACCCGACGCCCTTTACCTCTGCCCTAGCCATTGA
TACCGATGGACTCATTGACACGGAGCGACTTCACGTCACCTATGGCTTTAGCAAAGACTTTGGGACGGCCGGCCT
GCGCATTGGTGCCATCATCACGCGTAGCAAGGCCGTCGAGTCGGCCATTACGCCAGTCTTACGCTTCCACAATCC
CGCGGGGCCGAGCCTAGCTATTGGCGCCGCCATGCTTGAGGACCGCAAGTGGTGTCGAGAATTTGTCGAGTCATC
GCGCCAAAAGCTGGCAGCAGCTTACCGTCATGCAACCCAGGGTCTGCGAGCCATTGGCATTGACTATCTGCCCGG
CAGTAACGCCGGCTTCTTTGTCTGGATGGATCTATCGCCGTATTTGCCCACCGAGGACGAGTTGGGCGATGAGTC
GTGCCCCGAGTTTGCCCTGGCAAAGAGATTACGCGATTGTGGCGTCTTTCTTCATCCCCGAGAGGAACATTGCCT
CAACCCTGGATGGTTTCGCATGGTTTATACTCAGGATCCAGACATTGTGACTGAGGGCATCAGACGGTGAGTTTG
TTTGCTTTTTGAAACCAAACCAAAACCAAAAATTGCGTGTTAATGACGGGGCAGCATCAAGTCGGCAATATCCAA
AGCGGACGATGTGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail