Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1491
Gene name
LocationContig_14:128638..129583
Strand+
Gene length (bp)945
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family 3.7E-42 80 261

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56859|MET16_EMENI Phosphoadenosine phosphosulfate reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sA PE=3 SV=3 20 311 2.0E-119
sp|Q10270|MET16_SCHPO Probable phosphoadenosine phosphosulfate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met16 PE=3 SV=1 35 305 4.0E-100
sp|P18408|MET16_YEAST Phosphoadenosine phosphosulfate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET16 PE=1 SV=2 47 296 9.0E-89
sp|O06737|CYSH2_BACSU Probable phosphoadenosine phosphosulfate reductase OS=Bacillus subtilis (strain 168) GN=yitB PE=3 SV=2 55 286 4.0E-45
sp|Q9KCT3|CYSH_BACHD Phosphoadenosine phosphosulfate reductase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysH PE=3 SV=1 53 284 1.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56859|MET16_EMENI Phosphoadenosine phosphosulfate reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sA PE=3 SV=3 20 311 2.0E-119
sp|Q10270|MET16_SCHPO Probable phosphoadenosine phosphosulfate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met16 PE=3 SV=1 35 305 4.0E-100
sp|P18408|MET16_YEAST Phosphoadenosine phosphosulfate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET16 PE=1 SV=2 47 296 9.0E-89
sp|O06737|CYSH2_BACSU Probable phosphoadenosine phosphosulfate reductase OS=Bacillus subtilis (strain 168) GN=yitB PE=3 SV=2 55 286 4.0E-45
sp|Q9KCT3|CYSH_BACHD Phosphoadenosine phosphosulfate reductase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysH PE=3 SV=1 53 284 1.0E-44
sp|Q7NK24|CYSH_GLOVI Phosphoadenosine phosphosulfate reductase OS=Gloeobacter violaceus (strain PCC 7421) GN=cysH PE=3 SV=1 42 284 4.0E-43
sp|Q5WKF5|CYSH_BACSK Phosphoadenosine phosphosulfate reductase OS=Bacillus clausii (strain KSM-K16) GN=cysH PE=3 SV=1 57 284 4.0E-42
sp|Q8EQP2|CYSH_OCEIH Phosphoadenosine phosphosulfate reductase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cysH PE=3 SV=1 74 284 6.0E-42
sp|B1HXC6|CYSH_LYSSC Phosphoadenosine phosphosulfate reductase OS=Lysinibacillus sphaericus (strain C3-41) GN=cysH PE=3 SV=1 57 284 2.0E-41
sp|B7GG21|CYSH_ANOFW Phosphoadenosine phosphosulfate reductase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cysH PE=3 SV=1 79 284 1.0E-40
sp|P94498|CYSH1_BACSU Phosphoadenosine phosphosulfate reductase OS=Bacillus subtilis (strain 168) GN=cysH PE=2 SV=2 80 284 9.0E-39
sp|Q81T49|CYSH_BACAN Phosphoadenosine phosphosulfate reductase OS=Bacillus anthracis GN=cysH PE=3 SV=1 83 284 9.0E-39
sp|C3L9N6|CYSH_BACAC Phosphoadenosine phosphosulfate reductase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=cysH PE=3 SV=1 83 284 9.0E-39
sp|C3P516|CYSH_BACAA Phosphoadenosine phosphosulfate reductase OS=Bacillus anthracis (strain A0248) GN=cysH PE=3 SV=1 83 284 9.0E-39
sp|Q5L2X9|CYSH_GEOKA Phosphoadenosine phosphosulfate reductase OS=Geobacillus kaustophilus (strain HTA426) GN=cysH PE=3 SV=1 83 284 1.0E-37
sp|Q8CMX3|CYSH_STAES Phosphoadenosine phosphosulfate reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysH PE=3 SV=1 56 284 1.0E-37
sp|Q5HKZ5|CYSH_STAEQ Phosphoadenosine phosphosulfate reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysH PE=3 SV=1 56 284 1.0E-37
sp|A0RBN2|CYSH_BACAH Phosphoadenosine phosphosulfate reductase OS=Bacillus thuringiensis (strain Al Hakam) GN=cysH PE=3 SV=1 83 284 2.0E-37
sp|A7Z4H7|CYSH_BACMF Phosphoadenosine phosphosulfate reductase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cysH PE=3 SV=1 80 284 2.0E-37
sp|B7JG06|CYSH_BACC0 Phosphoadenosine phosphosulfate reductase OS=Bacillus cereus (strain AH820) GN=cysH PE=3 SV=1 83 284 2.0E-37
sp|C1EMR8|CYSH_BACC3 Phosphoadenosine phosphosulfate reductase OS=Bacillus cereus (strain 03BB102) GN=cysH PE=3 SV=1 57 284 3.0E-37
sp|B7INB4|CYSH_BACC2 Phosphoadenosine phosphosulfate reductase OS=Bacillus cereus (strain G9842) GN=cysH PE=3 SV=1 83 284 3.0E-37
sp|Q6HLD4|CYSH_BACHK Phosphoadenosine phosphosulfate reductase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cysH PE=3 SV=1 57 284 4.0E-37
sp|B7HKE5|CYSH_BACC7 Phosphoadenosine phosphosulfate reductase OS=Bacillus cereus (strain AH187) GN=cysH PE=3 SV=1 57 284 4.0E-37
sp|Q63DV9|CYSH_BACCZ Phosphoadenosine phosphosulfate reductase OS=Bacillus cereus (strain ZK / E33L) GN=cysH PE=3 SV=1 83 284 5.0E-37
sp|B7HHH6|CYSH_BACC4 Phosphoadenosine phosphosulfate reductase OS=Bacillus cereus (strain B4264) GN=cysH PE=3 SV=1 83 284 7.0E-37
sp|B9IV11|CYSH_BACCQ Phosphoadenosine phosphosulfate reductase OS=Bacillus cereus (strain Q1) GN=cysH PE=3 SV=1 83 284 7.0E-37
sp|Q73B76|CYSH_BACC1 Phosphoadenosine phosphosulfate reductase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysH PE=3 SV=1 83 284 1.0E-36
sp|Q81FZ1|CYSH_BACCR Phosphoadenosine phosphosulfate reductase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysH PE=3 SV=1 83 284 1.0E-36
sp|Q4L9F3|CYSH_STAHJ Phosphoadenosine phosphosulfate reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cysH PE=3 SV=1 83 284 1.0E-36
sp|C5D5A7|CYSH_GEOSW Phosphoadenosine phosphosulfate reductase OS=Geobacillus sp. (strain WCH70) GN=cysH PE=3 SV=1 79 284 1.0E-36
sp|A4IKB7|CYSH_GEOTN Phosphoadenosine phosphosulfate reductase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cysH PE=3 SV=1 83 284 2.0E-36
sp|A9VLI9|CYSH_BACWK Phosphoadenosine phosphosulfate reductase OS=Bacillus weihenstephanensis (strain KBAB4) GN=cysH PE=3 SV=1 83 284 5.0E-36
sp|A8FD22|CYSH_BACP2 Phosphoadenosine phosphosulfate reductase OS=Bacillus pumilus (strain SAFR-032) GN=cysH PE=3 SV=1 79 284 1.0E-35
sp|P56860|CYSH_DEIRA Phosphoadenosine phosphosulfate reductase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=cysH PE=3 SV=1 66 289 3.0E-35
sp|A7GMW0|CYSH_BACCN Phosphoadenosine phosphosulfate reductase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=cysH PE=3 SV=1 83 286 9.0E-35
sp|Q2S5G4|CYSH_SALRD Phosphoadenosine phosphosulfate reductase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=cysH PE=3 SV=1 57 284 2.0E-32
sp|Q49UL7|CYSH_STAS1 Phosphoadenosine phosphosulfate reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cysH PE=3 SV=1 83 284 5.0E-32
sp|Q3BPY3|CYSH_XANC5 Phosphoadenosine phosphosulfate reductase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cysH PE=3 SV=1 45 284 1.0E-31
sp|B5FGJ0|CYSH_VIBFM Phosphoadenosine phosphosulfate reductase OS=Vibrio fischeri (strain MJ11) GN=cysH PE=3 SV=1 83 284 4.0E-31
sp|Q5E839|CYSH_VIBF1 Phosphoadenosine phosphosulfate reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysH PE=3 SV=1 83 284 6.0E-31
sp|B4RYS5|CYSH_ALTMD Phosphoadenosine phosphosulfate reductase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=cysH1 PE=3 SV=1 47 284 8.0E-31
sp|Q9ADG3|CYSH_STRCO Phosphoadenosine phosphosulfate reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cysH PE=3 SV=1 50 285 1.0E-30
sp|Q8EB01|CYSH_SHEON Phosphoadenosine phosphosulfate reductase OS=Shewanella oneidensis (strain MR-1) GN=cysH PE=3 SV=1 83 284 2.0E-30
sp|Q5N1N0|CYSH_SYNP6 Phosphoadenosine phosphosulfate reductase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cysH PE=3 SV=1 57 284 2.0E-30
sp|Q55309|CYSH_SYNE7 Phosphoadenosine phosphosulfate reductase OS=Synechococcus elongatus (strain PCC 7942) GN=cysH PE=3 SV=2 57 284 2.0E-30
sp|B6ELM6|CYSH_ALISL Phosphoadenosine phosphosulfate reductase OS=Aliivibrio salmonicida (strain LFI1238) GN=cysH PE=3 SV=1 83 284 3.0E-30
sp|C3LRB8|CYSH_VIBCM Phosphoadenosine phosphosulfate reductase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysH PE=3 SV=1 83 284 6.0E-30
sp|Q9KUX2|CYSH_VIBCH Phosphoadenosine phosphosulfate reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysH PE=3 SV=1 83 284 6.0E-30
sp|A5F3I6|CYSH_VIBC3 Phosphoadenosine phosphosulfate reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysH PE=3 SV=1 83 284 6.0E-30
sp|P72794|CYSH_SYNY3 Phosphoadenosine phosphosulfate reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysH PE=3 SV=1 48 284 8.0E-30
sp|C1AUL1|CYSH_RHOOB Phosphoadenosine phosphosulfate reductase OS=Rhodococcus opacus (strain B4) GN=cysH PE=3 SV=1 110 284 9.0E-30
sp|B2SI06|CYSH_XANOP Phosphoadenosine phosphosulfate reductase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=cysH PE=3 SV=1 45 284 1.0E-29
sp|Q2P0H1|CYSH_XANOM Phosphoadenosine phosphosulfate reductase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cysH PE=3 SV=1 45 284 1.0E-29
sp|Q8PHC7|CYSH_XANAC Phosphoadenosine phosphosulfate reductase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysH PE=3 SV=1 45 284 2.0E-29
sp|Q98GP9|CYSH_RHILO Phosphoadenosine phosphosulfate reductase OS=Rhizobium loti (strain MAFF303099) GN=cysH PE=3 SV=1 47 284 2.0E-29
sp|C1A1H0|CYSH_RHOE4 Phosphoadenosine phosphosulfate reductase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=cysH PE=3 SV=1 110 284 4.0E-29
sp|B1XN08|CYSH_SYNP2 Phosphoadenosine phosphosulfate reductase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=cysH PE=3 SV=1 57 284 1.0E-28
sp|C6DDH2|CYSH_PECCP Phosphoadenosine phosphosulfate reductase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cysH PE=3 SV=1 54 284 2.0E-28
sp|Q5NRM3|CYSH_ZYMMO Phosphoadenosine phosphosulfate reductase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysH PE=3 SV=1 39 284 3.0E-28
sp|Q6LM60|CYSH_PHOPR Phosphoadenosine phosphosulfate reductase OS=Photobacterium profundum GN=cysH PE=3 SV=1 57 288 4.0E-28
sp|Q11B66|CYSH_CHESB Phosphoadenosine phosphosulfate reductase OS=Chelativorans sp. (strain BNC1) GN=cysH PE=3 SV=1 84 284 7.0E-28
sp|Q7MHA7|CYSH_VIBVY Phosphoadenosine phosphosulfate reductase OS=Vibrio vulnificus (strain YJ016) GN=cysH PE=3 SV=1 83 284 1.0E-27
sp|Q9PD82|CYSH_XYLFA Phosphoadenosine phosphosulfate reductase OS=Xylella fastidiosa (strain 9a5c) GN=cysH PE=3 SV=1 83 284 1.0E-27
sp|Q8P607|CYSH_XANCP Phosphoadenosine phosphosulfate reductase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysH PE=3 SV=1 54 284 1.0E-27
sp|B0RPG5|CYSH_XANCB Phosphoadenosine phosphosulfate reductase OS=Xanthomonas campestris pv. campestris (strain B100) GN=cysH PE=3 SV=1 54 284 1.0E-27
sp|Q4UY09|CYSH_XANC8 Phosphoadenosine phosphosulfate reductase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cysH PE=3 SV=1 54 284 1.0E-27
sp|B4F233|CYSH_PROMH Phosphoadenosine phosphosulfate reductase OS=Proteus mirabilis (strain HI4320) GN=cysH PE=3 SV=1 54 284 1.0E-27
sp|Q6D1A3|CYSH_PECAS Phosphoadenosine phosphosulfate reductase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysH PE=3 SV=1 57 284 2.0E-27
sp|Q8CWK6|CYSH_VIBVU Phosphoadenosine phosphosulfate reductase OS=Vibrio vulnificus (strain CMCP6) GN=cysH PE=3 SV=1 83 284 3.0E-27
sp|Q0A6T1|CYSH_ALKEH Phosphoadenosine phosphosulfate reductase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cysH PE=3 SV=1 37 285 8.0E-27
sp|Q87L92|CYSH_VIBPA Phosphoadenosine phosphosulfate reductase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysH PE=3 SV=1 39 284 9.0E-27
sp|P9WIK3|CYSH_MYCTU Probable phosphoadenosine phosphosulfate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysH PE=1 SV=1 92 284 9.0E-27
sp|P9WIK2|CYSH_MYCTO Probable phosphoadenosine phosphosulfate reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysH PE=3 SV=1 92 284 9.0E-27
sp|A5U586|CYSH_MYCTA Phosphoadenosine phosphosulfate reductase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cysH PE=3 SV=1 92 284 9.0E-27
sp|C1AQV5|CYSH_MYCBT Phosphoadenosine phosphosulfate reductase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=cysH PE=3 SV=1 92 284 9.0E-27
sp|A1KL82|CYSH_MYCBP Phosphoadenosine phosphosulfate reductase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=cysH PE=3 SV=1 92 284 9.0E-27
sp|P65669|CYSH_MYCBO Probable phosphoadenosine phosphosulfate reductase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysH PE=3 SV=1 92 284 9.0E-27
sp|Q9JRT1|CYSH_NEIMB Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysH1 PE=3 SV=1 94 284 2.0E-26
sp|A8ANW8|CYSH_CITK8 Phosphoadenosine phosphosulfate reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysH PE=3 SV=1 83 284 3.0E-26
sp|B0U6V9|CYSH_XYLFM Phosphoadenosine phosphosulfate reductase OS=Xylella fastidiosa (strain M12) GN=cysH PE=3 SV=1 83 284 3.0E-26
sp|B1MN34|CYSH_MYCA9 Phosphoadenosine phosphosulfate reductase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=cysH PE=3 SV=1 110 284 3.0E-26
sp|Q87DH1|CYSH_XYLFT Phosphoadenosine phosphosulfate reductase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysH PE=3 SV=1 83 284 4.0E-26
sp|B2IA30|CYSH_XYLF2 Phosphoadenosine phosphosulfate reductase OS=Xylella fastidiosa (strain M23) GN=cysH PE=3 SV=1 83 284 4.0E-26
sp|Q9JUD5|CYSH_NEIMA Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysH PE=3 SV=1 83 284 4.0E-26
sp|A6TD47|CYSH_KLEP7 Phosphoadenosine phosphosulfate reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysH PE=3 SV=1 58 284 8.0E-26
sp|B5Z3C5|CYSH_ECO5E Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysH PE=3 SV=1 58 284 1.0E-25
sp|Q8X7U3|CYSH_ECO57 Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O157:H7 GN=cysH PE=3 SV=3 58 284 1.0E-25
sp|Q1R7T6|CYSH_ECOUT Phosphoadenosine phosphosulfate reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=cysH PE=3 SV=1 58 284 2.0E-25
sp|A1AEU8|CYSH_ECOK1 Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O1:K1 / APEC GN=cysH PE=3 SV=1 58 284 2.0E-25
sp|B7MYR0|CYSH_ECO81 Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O81 (strain ED1a) GN=cysH PE=3 SV=1 58 284 2.0E-25
sp|B7MKM9|CYSH_ECO45 Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysH PE=3 SV=1 58 284 2.0E-25
sp|B5XV26|CYSH_KLEP3 Phosphoadenosine phosphosulfate reductase OS=Klebsiella pneumoniae (strain 342) GN=cysH PE=3 SV=1 58 284 2.0E-25
sp|A4WDV9|CYSH_ENT38 Phosphoadenosine phosphosulfate reductase OS=Enterobacter sp. (strain 638) GN=cysH PE=3 SV=1 83 284 2.0E-25
sp|A1JJS4|CYSH_YERE8 Phosphoadenosine phosphosulfate reductase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysH PE=3 SV=1 54 284 2.0E-25
sp|P17853|CYSH_SALTY Phosphoadenosine phosphosulfate reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysH PE=3 SV=3 58 284 4.0E-25
sp|B1JJG7|CYSH_YERPY Phosphoadenosine phosphosulfate reductase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cysH PE=3 SV=1 56 284 5.0E-25
sp|Q66ED2|CYSH_YERPS Phosphoadenosine phosphosulfate reductase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysH PE=3 SV=1 56 284 5.0E-25
sp|B2K567|CYSH_YERPB Phosphoadenosine phosphosulfate reductase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cysH PE=3 SV=1 56 284 5.0E-25
sp|A7FLY8|CYSH_YERP3 Phosphoadenosine phosphosulfate reductase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysH PE=3 SV=1 56 284 5.0E-25
sp|B5F429|CYSH_SALA4 Phosphoadenosine phosphosulfate reductase OS=Salmonella agona (strain SL483) GN=cysH PE=3 SV=1 58 284 5.0E-25
sp|A9N2E4|CYSH_SALPB Phosphoadenosine phosphosulfate reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysH PE=3 SV=1 58 284 5.0E-25
sp|B5RDR9|CYSH_SALG2 Phosphoadenosine phosphosulfate reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysH PE=3 SV=1 58 284 5.0E-25
sp|B5QW34|CYSH_SALEP Phosphoadenosine phosphosulfate reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=cysH PE=3 SV=1 58 284 5.0E-25
sp|B5FTU1|CYSH_SALDC Phosphoadenosine phosphosulfate reductase OS=Salmonella dublin (strain CT_02021853) GN=cysH PE=3 SV=1 58 284 5.0E-25
sp|B4TFY3|CYSH_SALHS Phosphoadenosine phosphosulfate reductase OS=Salmonella heidelberg (strain SL476) GN=cysH PE=3 SV=1 58 284 6.0E-25
sp|Q57KH9|CYSH_SALCH Phosphoadenosine phosphosulfate reductase OS=Salmonella choleraesuis (strain SC-B67) GN=cysH PE=3 SV=1 57 284 6.0E-25
sp|Q8FEI9|CYSH_ECOL6 Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysH PE=3 SV=3 58 284 6.0E-25
sp|Q0TEA4|CYSH_ECOL5 Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysH PE=3 SV=1 58 284 6.0E-25
sp|B7UHH4|CYSH_ECO27 Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysH PE=3 SV=1 58 284 6.0E-25
sp|B4T473|CYSH_SALNS Phosphoadenosine phosphosulfate reductase OS=Salmonella newport (strain SL254) GN=cysH PE=3 SV=1 58 284 7.0E-25
sp|Q3YY96|CYSH_SHISS Phosphoadenosine phosphosulfate reductase OS=Shigella sonnei (strain Ss046) GN=cysH PE=3 SV=1 83 284 7.0E-25
sp|Q31XM6|CYSH_SHIBS Phosphoadenosine phosphosulfate reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=cysH PE=3 SV=1 83 284 7.0E-25
sp|B2TZH2|CYSH_SHIB3 Phosphoadenosine phosphosulfate reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysH PE=3 SV=1 83 284 7.0E-25
sp|A8A3P3|CYSH_ECOHS Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O9:H4 (strain HS) GN=cysH PE=3 SV=1 83 284 7.0E-25
sp|B6I6F6|CYSH_ECOSE Phosphoadenosine phosphosulfate reductase OS=Escherichia coli (strain SE11) GN=cysH PE=3 SV=1 83 284 7.0E-25
sp|B7LXH5|CYSH_ECO8A Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O8 (strain IAI1) GN=cysH PE=3 SV=1 83 284 7.0E-25
sp|B7LEI1|CYSH_ECO55 Phosphoadenosine phosphosulfate reductase OS=Escherichia coli (strain 55989 / EAEC) GN=cysH PE=3 SV=1 83 284 7.0E-25
sp|A7ZQK5|CYSH_ECO24 Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysH PE=3 SV=1 83 284 7.0E-25
sp|B7VI86|CYSH_VIBTL Phosphoadenosine phosphosulfate reductase OS=Vibrio tasmaniensis (strain LGP32) GN=cysH PE=3 SV=1 83 284 9.0E-25
sp|B7LWP0|CYSH_ESCF3 Phosphoadenosine phosphosulfate reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|B7N6Z6|CYSH_ECOLU Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|P17854|CYSH_ECOLI Phosphoadenosine phosphosulfate reductase OS=Escherichia coli (strain K12) GN=cysH PE=1 SV=3 83 284 1.0E-24
sp|B1IUR7|CYSH_ECOLC Phosphoadenosine phosphosulfate reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|B1XDH5|CYSH_ECODH Phosphoadenosine phosphosulfate reductase OS=Escherichia coli (strain K12 / DH10B) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|C4ZZR6|CYSH_ECOBW Phosphoadenosine phosphosulfate reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|Q7UBT0|CYSH_SHIFL Phosphoadenosine phosphosulfate reductase OS=Shigella flexneri GN=cysH PE=3 SV=3 83 284 1.0E-24
sp|B1LQ85|CYSH_ECOSM Phosphoadenosine phosphosulfate reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|B7NT99|CYSH_ECO7I Phosphoadenosine phosphosulfate reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|B2VG05|CYSH_ERWT9 Phosphoadenosine phosphosulfate reductase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|B8D7V6|CYSH_BUCAT Phosphoadenosine phosphosulfate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|A7MSZ6|CYSH_VIBCB Phosphoadenosine phosphosulfate reductase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cysH PE=3 SV=1 83 284 1.0E-24
sp|Q0T1I6|CYSH_SHIF8 Phosphoadenosine phosphosulfate reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=cysH PE=3 SV=1 83 284 2.0E-24
sp|B4TTX7|CYSH_SALSV Phosphoadenosine phosphosulfate reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=cysH PE=3 SV=1 58 284 2.0E-24
sp|Q1LTP3|CYSH_BAUCH Phosphoadenosine phosphosulfate reductase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysH PE=3 SV=1 83 287 2.0E-24
sp|A9MF18|CYSH_SALAR Phosphoadenosine phosphosulfate reductase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysH PE=3 SV=1 83 284 3.0E-24
sp|B5BEZ7|CYSH_SALPK Phosphoadenosine phosphosulfate reductase OS=Salmonella paratyphi A (strain AKU_12601) GN=cysH PE=3 SV=1 58 284 4.0E-24
sp|Q5PEH9|CYSH_SALPA Phosphoadenosine phosphosulfate reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysH PE=3 SV=1 58 284 4.0E-24
sp|Q2NVN2|CYSH_SODGM Phosphoadenosine phosphosulfate reductase OS=Sodalis glossinidius (strain morsitans) GN=cysH PE=3 SV=1 83 284 5.0E-24
sp|A7MJ65|CYSH_CROS8 Phosphoadenosine phosphosulfate reductase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysH PE=3 SV=1 83 284 5.0E-24
sp|P57501|CYSH_BUCAI Phosphoadenosine phosphosulfate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysH PE=3 SV=1 83 284 5.0E-24
sp|A8G9X8|CYSH_SERP5 Phosphoadenosine phosphosulfate reductase OS=Serratia proteamaculans (strain 568) GN=cysH PE=3 SV=1 54 284 6.0E-24
sp|B8D9K4|CYSH_BUCA5 Phosphoadenosine phosphosulfate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cysH PE=3 SV=1 83 284 8.0E-24
sp|Q8UH67|CYSH_AGRFC Phosphoadenosine phosphosulfate reductase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysH PE=3 SV=1 110 284 1.0E-23
sp|Q8Z460|CYSH_SALTI Phosphoadenosine phosphosulfate reductase OS=Salmonella typhi GN=cysH PE=3 SV=3 58 284 1.0E-23
sp|Q32CG5|CYSH_SHIDS Phosphoadenosine phosphosulfate reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysH PE=3 SV=1 58 284 1.0E-23
sp|Q7MB85|CYSH_PHOLL Phosphoadenosine phosphosulfate reductase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysH PE=3 SV=1 83 284 1.0E-23
sp|Q9RFS6|CYSH_BURCE Thioredoxin-dependent 5'-adenylylsulfate reductase OS=Burkholderia cepacia GN=cysH PE=1 SV=1 45 284 3.0E-23
sp|P56891|CYSH_RHIME Phosphoadenosine phosphosulfate reductase OS=Rhizobium meliloti (strain 1021) GN=cysH PE=3 SV=1 35 284 3.0E-23
sp|P52672|CYSH_THIRO Phosphoadenosine phosphosulfate reductase OS=Thiocapsa roseopersicina GN=cysH PE=3 SV=1 58 285 1.0E-22
sp|O33579|CYSH_RHITR Phosphoadenosine phosphosulfate reductase (Fragment) OS=Rhizobium tropici GN=cysH PE=3 SV=1 115 284 1.0E-21
sp|Q02KP7|CYSH_PSEAB Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysH PE=3 SV=1 66 284 4.0E-19
sp|B7VBC3|CYSH_PSEA8 Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysH PE=3 SV=1 66 284 4.0E-19
sp|O05927|CYSH_PSEAE Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysH PE=1 SV=2 66 284 4.0E-19
sp|Q6Z4A7|APR1_ORYSJ Probable 5'-adenylylsulfate reductase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=APR1 PE=2 SV=1 57 285 4.0E-15
sp|P92981|APR2_ARATH 5'-adenylylsulfate reductase 2, chloroplastic OS=Arabidopsis thaliana GN=APR2 PE=1 SV=2 57 285 1.0E-14
sp|P92980|APR3_ARATH 5'-adenylylsulfate reductase 3, chloroplastic OS=Arabidopsis thaliana GN=APR3 PE=2 SV=2 28 284 6.0E-13
sp|P92979|APR1_ARATH 5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=APR1 PE=1 SV=2 57 284 6.0E-12
sp|O74841|FAD1_SCHPO Probable FAD synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1235.04c PE=3 SV=1 108 272 1.0E-07
sp|Q6ING7|FLAD1_XENLA FAD synthase OS=Xenopus laevis GN=flad1 PE=2 SV=1 174 259 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1491
MTQQASQSPLLDDKMDHDIESGYVSGHSDYSPSPSVKAESAKSRPKVSLTKEHIDFLNEQMEPMHPMDILRFCKV
MFPNLYQSTAFGLTGLVTMDMLSKIQQENPNSKTVHLIFLDTLYHFSETYELIDRVRERYPNVPVHIFKPMDVET
ASEFEATYGAEVWKTADEMYDWLVKVEPLQRAFDQLQVAAVLNGRRRSQGAARGSIPIIELDEERGIIKINPMAT
WSFSQVNDYIRQNNVPYNALLDRGYKSVGDWHSTSPVGEGEDERSGRWKGQAKTECGIHNKQSRYAQYLAEMENK
KKEPAGSQIIEPVS*
Coding >OphauB2|1491
ATGACGCAACAAGCCTCGCAATCGCCACTATTGGACGACAAGATGGACCACGACATTGAGTCGGGGTACGTCTCC
GGCCACTCCGACTACTCGCCCTCGCCCAGCGTCAAGGCAGAAAGTGCAAAGTCTCGACCCAAGGTGTCGCTCACC
AAGGAGCACATTGACTTTCTCAATGAGCAGATGGAGCCCATGCACCCCATGGACATTTTGCGCTTCTGCAAAGTC
ATGTTTCCAAATCTCTACCAGTCAACCGCGTTTGGTTTGACGGGGCTCGTCACCATGGACATGCTGTCCAAGATT
CAGCAAGAGAATCCAAACTCCAAGACTGTCCATCTCATCTTCCTCGACACCCTCTACCATTTCTCAGAAACCTAT
GAGCTCATTGACCGCGTTCGTGAGCGATACCCCAATGTCCCGGTACACATTTTCAAGCCCATGGACGTTGAGACA
GCCAGCGAGTTCGAGGCCACCTATGGGGCCGAGGTGTGGAAGACGGCCGACGAAATGTACGACTGGCTCGTCAAG
GTTGAGCCACTGCAGCGAGCATTCGACCAGCTCCAGGTGGCGGCTGTCCTCAATGGCCGACGGCGATCACAGGGT
GCTGCCCGTGGTTCCATTCCCATCATCGAACTCGACGAAGAGCGCGGCATCATCAAGATTAACCCCATGGCCACT
TGGTCATTCTCTCAAGTCAACGACTATATCCGCCAAAATAATGTGCCGTACAACGCCCTGCTGGACCGCGGTTAC
AAGTCGGTCGGCGACTGGCACTCGACGAGTCCCGTCGGCGAGGGTGAGGATGAGCGCTCCGGCCGCTGGAAAGGA
CAGGCCAAGACTGAGTGCGGAATCCACAACAAGCAGTCGCGATATGCCCAGTACCTTGCCGAGATGGAAAACAAG
AAGAAGGAACCCGCCGGCAGCCAAATAATTGAGCCTGTCTCCTGA
Transcript >OphauB2|1491
ATGACGCAACAAGCCTCGCAATCGCCACTATTGGACGACAAGATGGACCACGACATTGAGTCGGGGTACGTCTCC
GGCCACTCCGACTACTCGCCCTCGCCCAGCGTCAAGGCAGAAAGTGCAAAGTCTCGACCCAAGGTGTCGCTCACC
AAGGAGCACATTGACTTTCTCAATGAGCAGATGGAGCCCATGCACCCCATGGACATTTTGCGCTTCTGCAAAGTC
ATGTTTCCAAATCTCTACCAGTCAACCGCGTTTGGTTTGACGGGGCTCGTCACCATGGACATGCTGTCCAAGATT
CAGCAAGAGAATCCAAACTCCAAGACTGTCCATCTCATCTTCCTCGACACCCTCTACCATTTCTCAGAAACCTAT
GAGCTCATTGACCGCGTTCGTGAGCGATACCCCAATGTCCCGGTACACATTTTCAAGCCCATGGACGTTGAGACA
GCCAGCGAGTTCGAGGCCACCTATGGGGCCGAGGTGTGGAAGACGGCCGACGAAATGTACGACTGGCTCGTCAAG
GTTGAGCCACTGCAGCGAGCATTCGACCAGCTCCAGGTGGCGGCTGTCCTCAATGGCCGACGGCGATCACAGGGT
GCTGCCCGTGGTTCCATTCCCATCATCGAACTCGACGAAGAGCGCGGCATCATCAAGATTAACCCCATGGCCACT
TGGTCATTCTCTCAAGTCAACGACTATATCCGCCAAAATAATGTGCCGTACAACGCCCTGCTGGACCGCGGTTAC
AAGTCGGTCGGCGACTGGCACTCGACGAGTCCCGTCGGCGAGGGTGAGGATGAGCGCTCCGGCCGCTGGAAAGGA
CAGGCCAAGACTGAGTGCGGAATCCACAACAAGCAGTCGCGATATGCCCAGTACCTTGCCGAGATGGAAAACAAG
AAGAAGGAACCCGCCGGCAGCCAAATAATTGAGCCTGTCTCCTGA
Gene >OphauB2|1491
ATGACGCAACAAGCCTCGCAATCGCCACTATTGGACGACAAGATGGACCACGACATTGAGTCGGGGTACGTCTCC
GGCCACTCCGACTACTCGCCCTCGCCCAGCGTCAAGGCAGAAAGTGCAAAGTCTCGACCCAAGGTGTCGCTCACC
AAGGAGCACATTGACTTTCTCAATGAGCAGATGGAGCCCATGCACCCCATGGACATTTTGCGCTTCTGCAAAGTC
ATGTTTCCAAATCTCTACCAGTCAACCGCGTTTGGTTTGACGGGGCTCGTCACCATGGACATGCTGTCCAAGATT
CAGCAAGAGAATCCAAACTCCAAGACTGTCCATCTCATCTTCCTCGACACCCTCTACCATTTCTCAGAAACCTAT
GAGCTCATTGACCGCGTTCGTGAGCGATACCCCAATGTCCCGGTACACATTTTCAAGCCCATGGACGTTGAGACA
GCCAGCGAGTTCGAGGCCACCTATGGGGCCGAGGTGTGGAAGACGGCCGACGAAATGTACGACTGGCTCGTCAAG
GTTGAGCCACTGCAGCGAGCATTCGACCAGCTCCAGGTGGCGGCTGTCCTCAATGGCCGACGGCGATCACAGGGT
GCTGCCCGTGGTTCCATTCCCATCATCGAACTCGACGAAGAGCGCGGCATCATCAAGATTAACCCCATGGCCACT
TGGTCATTCTCTCAAGTCAACGACTATATCCGCCAAAATAATGTGCCGTACAACGCCCTGCTGGACCGCGGTTAC
AAGTCGGTCGGCGACTGGCACTCGACGAGTCCCGTCGGCGAGGGTGAGGATGAGCGCTCCGGCCGCTGGAAAGGA
CAGGCCAAGACTGAGTGCGGAATCCACAACAAGCAGTCGCGATATGCCCAGTACCTTGCCGAGATGGAAAACAAG
AAGAAGGAACCCGCCGGCAGCCAAATAATTGAGCCTGTCTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail