Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1488
Gene name
LocationContig_14:121317..121901
Strand+
Gene length (bp)584
Transcript length (bp)402
Coding sequence length (bp)402
Protein length (aa) 134

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74383|YNV8_SCHPO Uncharacterized protein C3H7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.08c PE=4 SV=1 28 126 9.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 39 58 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1488
MASPLARRLFSTSMRRLETSSAAHSQEQLKRDTKRNPELMILGAVMVAALGGAGFYLGRSPTMSTSENPVNIAKD
GMPWEGNTEGKYKYHPGGDPSREPRHAPSALNTVIIPDVTLPKQEHDKFNKWGKDGYP*
Coding >OphauB2|1488
ATGGCCTCTCCTCTTGCGCGCCGCCTCTTTTCCACCTCGATGCGTCGGCTCGAGACCTCGTCGGCCGCTCATAGC
CAAGAACAGCTCAAGCGCGACACCAAGCGCAATCCCGAACTCATGATTCTCGGAGCCGTCATGGTTGCTGCTCTT
GGCGGTGCTGGCTTCTACTTGGGCCGCTCTCCCACAATGTCGACATCCGAAAACCCCGTCAACATTGCCAAGGAC
GGCATGCCCTGGGAGGGCAACACCGAGGGCAAATACAAGTACCACCCGGGCGGCGACCCCTCGAGGGAACCCCGT
CACGCCCCCAGCGCCCTCAATACCGTCATTATACCAGACGTTACCCTGCCCAAGCAAGAGCACGACAAGTTTAAC
AAGTGGGGCAAGGATGGCTATCCCTAA
Transcript >OphauB2|1488
ATGGCCTCTCCTCTTGCGCGCCGCCTCTTTTCCACCTCGATGCGTCGGCTCGAGACCTCGTCGGCCGCTCATAGC
CAAGAACAGCTCAAGCGCGACACCAAGCGCAATCCCGAACTCATGATTCTCGGAGCCGTCATGGTTGCTGCTCTT
GGCGGTGCTGGCTTCTACTTGGGCCGCTCTCCCACAATGTCGACATCCGAAAACCCCGTCAACATTGCCAAGGAC
GGCATGCCCTGGGAGGGCAACACCGAGGGCAAATACAAGTACCACCCGGGCGGCGACCCCTCGAGGGAACCCCGT
CACGCCCCCAGCGCCCTCAATACCGTCATTATACCAGACGTTACCCTGCCCAAGCAAGAGCACGACAAGTTTAAC
AAGTGGGGCAAGGATGGCTATCCCTAA
Gene >OphauB2|1488
ATGGCCTCTCCTCTTGCGCGCCGCCTCTTTTCCACCTCGATGCGTCGGCTCGAGACCTCGTCGGCCGCTCATAGC
CAAGAACAGCTCAAGCGCGACACCAAGCGCAATCCCGAACTCATGGTCCGTAGACGCCTCTCCTTCTTGCCCTAG
GACCTTTTCGAAAAGATGAAAGAAGAGAAGAGTCGCTCGCATGGCTGATTGCGTGCTAGATTCTCGGAGCCGTCA
TGGTTGCTGCTCTTGGCGGTGCTGGCTTCTACTTGGGTACGCCCTCCTCCTCCCCTTTGCTCATGAGCTCTGCAT
ACATTTGACAGACTCGCGACAAATTCACCCAGCGCTGACCCCCTCCCTCTCCAGGCCGCTCTCCCACAATGTCGA
CATCCGAAAACCCCGTCAACATTGCCAAGGACGGCATGCCCTGGGAGGGCAACACCGAGGGCAAATACAAGTACC
ACCCGGGCGGCGACCCCTCGAGGGAACCCCGTCACGCCCCCAGCGCCCTCAATACCGTCATTATACCAGACGTTA
CCCTGCCCAAGCAAGAGCACGACAAGTTTAACAAGTGGGGCAAGGATGGCTATCCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail