Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1484
Gene name
LocationContig_14:108027..109211
Strand+
Gene length (bp)1184
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 1.2E-13 30 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74405|SET11_SCHPO Ribosomal lysine N-methyltransferase set11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set11 PE=1 SV=1 24 314 1.0E-17
sp|P58467|SETD4_MOUSE SET domain-containing protein 4 OS=Mus musculus GN=Setd4 PE=2 SV=1 13 241 6.0E-16
sp|Q9NVD3|SETD4_HUMAN SET domain-containing protein 4 OS=Homo sapiens GN=SETD4 PE=2 SV=1 14 255 1.0E-15
sp|Q03942|RKM2_YEAST Ribosomal lysine N-methyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RKM2 PE=1 SV=1 89 281 6.0E-11
sp|Q5ZK17|SETD6_CHICK N-lysine methyltransferase SETD6 OS=Gallus gallus GN=SETD6 PE=2 SV=2 30 236 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74405|SET11_SCHPO Ribosomal lysine N-methyltransferase set11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set11 PE=1 SV=1 24 314 1.0E-17
sp|P58467|SETD4_MOUSE SET domain-containing protein 4 OS=Mus musculus GN=Setd4 PE=2 SV=1 13 241 6.0E-16
sp|Q9NVD3|SETD4_HUMAN SET domain-containing protein 4 OS=Homo sapiens GN=SETD4 PE=2 SV=1 14 255 1.0E-15
sp|Q03942|RKM2_YEAST Ribosomal lysine N-methyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RKM2 PE=1 SV=1 89 281 6.0E-11
sp|Q5ZK17|SETD6_CHICK N-lysine methyltransferase SETD6 OS=Gallus gallus GN=SETD6 PE=2 SV=2 30 236 1.0E-07
sp|Q8TBK2|SETD6_HUMAN N-lysine methyltransferase SETD6 OS=Homo sapiens GN=SETD6 PE=1 SV=2 30 237 6.0E-07
sp|Q91WC0|SETD3_MOUSE Histone-lysine N-methyltransferase setd3 OS=Mus musculus GN=Setd3 PE=1 SV=1 2 246 1.0E-06
sp|B0VX69|SETD3_CALJA Histone-lysine N-methyltransferase setd3 OS=Callithrix jacchus GN=SETD3 PE=3 SV=2 2 248 3.0E-06
sp|B5FW36|SETD3_OTOGA Histone-lysine N-methyltransferase setd3 OS=Otolemur garnettii GN=SETD3 PE=3 SV=1 6 246 5.0E-06
sp|Q86TU7|SETD3_HUMAN Histone-lysine N-methyltransferase setd3 OS=Homo sapiens GN=SETD3 PE=1 SV=1 2 248 6.0E-06
sp|B1MTJ4|SETD3_CALMO Histone-lysine N-methyltransferase setd3 OS=Callicebus moloch GN=SETD3 PE=3 SV=2 2 248 7.0E-06
sp|Q6INM2|SETD6_XENLA N-lysine methyltransferase setd6 OS=Xenopus laevis GN=setd6 PE=2 SV=1 32 236 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6617
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1484 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3789

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1484
MDAVGNLVRSADEKGVQIMGVAPAFFPGRGLGIMATNDMDEGHVIMTIPTLAIRSLHTTCQEISSKLCPSISLHG
LLAAEFALDDAKSADWASLVPQWKHFETSMPCLWPRELQKCLPAEAKRLLAKQCSNFDNDWDKFKKAFAHHCRQD
YLYAWLLIGTRAFYYETPTTMALPKHDRLALLPVADFLNHADSGCVFRCSSESYTITTERPYRKGDEIYLSYGDH
SNDYLLVEYGFLLGENKWDKVCLDDIILPKLSAEQKRELSDNGPQWQSYIDGEEDVEGTLAKAAKLLLVLLQEYL
DSVEEMRMRIRALQIGQECQKDLLEKRWEQMEVMIKEAMATTWFAV*
Coding >OphauB2|1484
ATGGACGCCGTGGGCAATCTTGTCCGCAGCGCCGATGAAAAGGGAGTCCAGATAATGGGCGTTGCGCCCGCCTTT
TTCCCTGGTCGAGGTCTCGGAATCATGGCCACCAATGACATGGATGAAGGACATGTCATCATGACAATACCCACT
CTGGCAATTCGCAGCCTGCACACGACTTGTCAAGAAATTTCATCCAAACTGTGTCCTAGCATTTCTCTTCACGGC
CTTTTGGCTGCCGAGTTTGCTCTTGATGATGCCAAGTCGGCAGATTGGGCCAGTTTGGTGCCGCAGTGGAAACAT
TTTGAGACGAGTATGCCGTGTCTTTGGCCTCGAGAGCTGCAAAAATGCCTCCCTGCCGAGGCCAAACGACTATTG
GCCAAGCAGTGTTCCAATTTCGACAATGACTGGGACAAGTTTAAAAAGGCGTTTGCGCACCATTGCCGGCAAGAT
TATCTATACGCCTGGCTTCTCATTGGCACAAGGGCCTTTTACTACGAGACGCCAACTACAATGGCACTGCCAAAG
CATGATCGATTAGCTCTACTTCCCGTCGCCGACTTTCTTAACCATGCAGATTCAGGTTGTGTCTTTAGATGCTCG
TCCGAGAGCTACACCATCACCACGGAGCGTCCTTATCGCAAAGGTGACGAGATTTACCTGTCATATGGAGACCAT
TCCAACGACTATTTACTAGTCGAATATGGATTCTTGCTGGGCGAGAACAAATGGGACAAGGTGTGTCTTGACGAT
ATTATTCTCCCCAAGCTGAGTGCAGAGCAAAAGCGCGAATTGAGCGACAATGGGCCACAGTGGCAGAGCTACATT
GATGGTGAGGAAGACGTGGAGGGTACTCTGGCCAAGGCTGCCAAGCTGTTGCTGGTTTTGCTTCAAGAATATCTG
GATAGTGTCGAGGAAATGCGGATGCGAATTCGCGCCTTGCAAATTGGCCAAGAGTGTCAAAAGGATTTGCTGGAG
AAGCGCTGGGAGCAGATGGAGGTGATGATTAAGGAAGCAATGGCGACTACATGGTTCGCAGTATGA
Transcript >OphauB2|1484
ATGGACGCCGTGGGCAATCTTGTCCGCAGCGCCGATGAAAAGGGAGTCCAGATAATGGGCGTTGCGCCCGCCTTT
TTCCCTGGTCGAGGTCTCGGAATCATGGCCACCAATGACATGGATGAAGGACATGTCATCATGACAATACCCACT
CTGGCAATTCGCAGCCTGCACACGACTTGTCAAGAAATTTCATCCAAACTGTGTCCTAGCATTTCTCTTCACGGC
CTTTTGGCTGCCGAGTTTGCTCTTGATGATGCCAAGTCGGCAGATTGGGCCAGTTTGGTGCCGCAGTGGAAACAT
TTTGAGACGAGTATGCCGTGTCTTTGGCCTCGAGAGCTGCAAAAATGCCTCCCTGCCGAGGCCAAACGACTATTG
GCCAAGCAGTGTTCCAATTTCGACAATGACTGGGACAAGTTTAAAAAGGCGTTTGCGCACCATTGCCGGCAAGAT
TATCTATACGCCTGGCTTCTCATTGGCACAAGGGCCTTTTACTACGAGACGCCAACTACAATGGCACTGCCAAAG
CATGATCGATTAGCTCTACTTCCCGTCGCCGACTTTCTTAACCATGCAGATTCAGGTTGTGTCTTTAGATGCTCG
TCCGAGAGCTACACCATCACCACGGAGCGTCCTTATCGCAAAGGTGACGAGATTTACCTGTCATATGGAGACCAT
TCCAACGACTATTTACTAGTCGAATATGGATTCTTGCTGGGCGAGAACAAATGGGACAAGGTGTGTCTTGACGAT
ATTATTCTCCCCAAGCTGAGTGCAGAGCAAAAGCGCGAATTGAGCGACAATGGGCCACAGTGGCAGAGCTACATT
GATGGTGAGGAAGACGTGGAGGGTACTCTGGCCAAGGCTGCCAAGCTGTTGCTGGTTTTGCTTCAAGAATATCTG
GATAGTGTCGAGGAAATGCGGATGCGAATTCGCGCCTTGCAAATTGGCCAAGAGTGTCAAAAGGATTTGCTGGAG
AAGCGCTGGGAGCAGATGGAGGTGATGATTAAGGAAGCAATGGCGACTACATGGTTCGCAGTATGA
Gene >OphauB2|1484
ATGGACGCCGTGGGCAATCTTGTCCGCAGCGCCGATGAAAAGGGAGTCCAGATAATGGGCGTTGCGCCCGCCTTT
TTCCCTGGTCGAGGTCTCGGAATCATGGCCACCAATGACATGGATGTACGCCAAGCAGAGTTCAGTATGCAAGCT
ATGCAAGTGCCCGTCTAACCAGCGCCTAGGAAGGACATGTCATCATGACAATACCCACTCTGGCAATTCGCAGCC
TGCACACGACTTGTCAAGAAATTTCATCCAAACTGTGTCCTAGCATTTCTCTTCACGGCCTTTTGGCTGCCGAGT
TTGCTCTTGATGATGCCAAGTCGGCAGATTGGGCCAGTTTGGTGCCGCAGTGGAAACATTTTGAGACGAGTATGC
CGTGTCTTTGGCCTCGAGAGCTGCAAAAATGCCTCCCTGCCGAGGCCAAACGACTATTGGCCAAGCAGTGTTCCA
ATTTCGACAATGACTGGGACAAGTTTAAAAAGGCGTTTGCGCACCATTGCCGGCAAGATTATCTATACGCCTGGC
TTCTCATTGGCACAAGGGCCTTTTACTACGAGACGCCAACTACAATGGCACTGCCAAAGCATGATCGATTAGCTC
TACTTCCCGTCGCCGACTTTCTTAACCATGCAGATTCAGGTTGTGTCTTTAGATGCTCGTCCGAGAGCTACACCA
TCACCACGGAGCGTCCTTATCGCAAAGGTGACGAGATTTACCTGTCATATGGAGACCATTCCAACGACTATTTAC
TAGTCGAATATGGATTCTTGCTGGGCGAGAACAAATGGGACAAGGTGTGTCTTGACGATATTATTCTCCCCAAGC
TGAGTGCAGAGCAAAAGCGCGAATTGAGCGACAATGGGTACCTGGGAGAATTCATGCTCCACACTGAGTCAAGAG
CATGTGATAATGTCTGCATTGCGTTGCGCTTACTTTGCTGCCAAAGGCCACAGTGGCAGAGCTACATTGATGGTG
AGGAAGACGTGGAGGGTACTCTGGCCAAGGCTGCCAAGCTGTTGCTGGTTTTGCTTCAAGAATATCTGGATAGTG
TCGAGGAAATGCGGATGCGAATTCGCGCCTTGCAAATTGGCCAAGAGTGTCAAAAGGATTTGCTGGAGAAGCGCT
GGGAGCAGATGGAGGTGATGATTAAGGAAGCAATGGCGACTACATGGTTCGCAGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail