Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1483
Gene name
LocationContig_14:105744..107192
Strand+
Gene length (bp)1448
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.8E-27 31 219
PF08386 Abhydrolase_4 TAP-like protein 4.2E-14 358 451

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 1 449 1.0E-29
sp|P9WHR3|CAEA_MYCTU Carboxylesterase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeA PE=1 SV=1 1 449 1.0E-29
sp|P9WHR2|CAEA_MYCTO Carboxylesterase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeA PE=3 SV=1 1 449 1.0E-29
sp|P65822|Y2247_MYCBO Putative hydrolase Mb2247c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2247c PE=3 SV=1 1 212 5.0E-28
sp|P9WHR5|CAEB_MYCTU Carboxylesterase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeB PE=1 SV=1 1 212 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P65824|Y2248_MYCBO Putative hydrolase Mb2248c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2248c PE=3 SV=1 1 449 1.0E-29
sp|P9WHR3|CAEA_MYCTU Carboxylesterase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeA PE=1 SV=1 1 449 1.0E-29
sp|P9WHR2|CAEA_MYCTO Carboxylesterase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeA PE=3 SV=1 1 449 1.0E-29
sp|P65822|Y2247_MYCBO Putative hydrolase Mb2247c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2247c PE=3 SV=1 1 212 5.0E-28
sp|P9WHR5|CAEB_MYCTU Carboxylesterase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=caeB PE=1 SV=1 1 212 5.0E-28
sp|P9WHR4|CAEB_MYCTO Carboxylesterase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=caeB PE=3 SV=1 1 212 5.0E-28
sp|Q54410|TAP_STRLI Tripeptidyl aminopeptidase OS=Streptomyces lividans GN=tap PE=1 SV=1 1 401 5.0E-26
sp|Q9FCD7|TAP_STRCO Tripeptidyl aminopeptidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tap PE=3 SV=1 1 401 5.0E-26
sp|P34211|YUAR_ECOLI Putative hydrolase YuaR OS=Escherichia coli (strain K12) GN=yuaR PE=3 SV=3 13 292 4.0E-17
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup970
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1483 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03759
Ophiocordyceps camponoti-rufipedis Ophun1|284
Ophiocordyceps camponoti-rufipedis Ophun1|3302
Ophiocordyceps kimflemingae Ophio5|372
Ophiocordyceps kimflemingae Ophio5|4086
Ophiocordyceps subramaniannii Hirsu2|7742

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1483
MDYNAPKDAQNCITLGMVRIKSNNSQPLGNLIVNPGGPGYSPVSAFVLQQQDALVSENLIKHYNIIAPDPRGVGL
SNPVQCNASLYNQRVPSYIANAQDFDNLVAHNQALGESCTQMTGPAINFLDTVSVAKDLDQIRQALGDEKLDFLG
VSYGTFLGSQYAELFPQRVGRMVLDGILGHSQSDADAMLTEATTFEAMFNSFARLCYTAPECAFYQQDLPSIFDQ
MVDEANEQPIPAPGCLVPADAATRNENSQACRSDVTGYELISSTQGLMSSLIPWPAISQALKEAYEGNATLLSST
LVTSNVPPIDQDYNPFAHIAISCQDWVRGTGPRAAADLMAKLIAARALAPHTRGVTEMLNIQTSCLGWPAPLVNP
QRLFNQKQLAQAPPILLVNAFQDPSTSIAWALGVREQMPTAVSIFRSGYGHISYWHYGDTQKAIDGFLLDGEMPA
DLAIFES*
Coding >OphauB2|1483
ATGGACTACAATGCCCCCAAAGATGCTCAAAACTGCATTACCCTTGGCATGGTTCGCATCAAGTCAAATAACTCT
CAGCCCCTTGGAAACCTTATCGTTAACCCCGGCGGCCCTGGATATTCCCCTGTTAGTGCATTTGTTCTTCAACAG
CAAGATGCACTCGTCAGCGAAAACCTCATAAAGCACTACAATATAATCGCACCGGACCCTCGTGGTGTAGGGCTT
AGCAACCCTGTACAGTGCAATGCTAGCTTGTACAACCAGCGCGTGCCTAGTTATATTGCCAACGCGCAAGACTTT
GATAATCTAGTCGCACATAATCAGGCCCTGGGTGAATCTTGCACTCAGATGACGGGCCCGGCCATTAATTTTTTA
GATACCGTTTCGGTAGCCAAGGACCTTGACCAGATACGACAGGCTCTTGGTGATGAGAAGCTAGACTTCTTGGGA
GTTTCTTATGGAACATTTTTGGGGAGCCAGTATGCAGAACTATTTCCCCAAAGGGTTGGCCGCATGGTTCTCGAC
GGCATCCTCGGGCATTCACAAAGCGATGCCGATGCCATGTTAACGGAAGCCACAACTTTCGAGGCCATGTTTAAT
AGCTTTGCTCGATTGTGCTACACAGCTCCCGAATGCGCCTTTTATCAACAAGACTTACCCTCCATCTTTGACCAA
ATGGTTGACGAGGCTAATGAGCAGCCAATCCCGGCTCCTGGCTGTCTTGTTCCCGCAGACGCGGCGACAAGAAAC
GAAAACAGCCAAGCCTGTCGGTCTGATGTCACGGGATATGAGCTTATAAGCAGCACACAAGGCCTCATGTCTAGC
CTAATCCCGTGGCCCGCCATCTCTCAAGCTTTAAAAGAGGCCTACGAGGGCAACGCGACATTGCTATCCTCGACA
CTCGTCACCTCCAATGTGCCCCCTATTGACCAAGACTACAACCCCTTTGCGCATATCGCCATTTCCTGCCAAGAC
TGGGTGCGCGGAACTGGACCTCGGGCCGCAGCAGATCTCATGGCCAAGCTGATTGCAGCTCGCGCTCTGGCTCCC
CATACGCGTGGCGTAACCGAAATGTTGAATATTCAAACAAGTTGCCTCGGCTGGCCGGCGCCCTTGGTAAATCCG
CAGCGACTGTTTAACCAGAAACAATTAGCCCAGGCTCCTCCGATTCTCCTCGTTAATGCGTTTCAAGACCCGTCA
ACAAGCATCGCATGGGCACTTGGCGTTCGGGAGCAAATGCCAACAGCAGTGAGCATATTTCGCAGTGGATACGGC
CATATAAGTTATTGGCACTATGGCGACACGCAGAAAGCTATTGATGGCTTCTTGCTCGATGGGGAAATGCCCGCG
GACCTTGCTATCTTTGAGTCGTGA
Transcript >OphauB2|1483
ATGGACTACAATGCCCCCAAAGATGCTCAAAACTGCATTACCCTTGGCATGGTTCGCATCAAGTCAAATAACTCT
CAGCCCCTTGGAAACCTTATCGTTAACCCCGGCGGCCCTGGATATTCCCCTGTTAGTGCATTTGTTCTTCAACAG
CAAGATGCACTCGTCAGCGAAAACCTCATAAAGCACTACAATATAATCGCACCGGACCCTCGTGGTGTAGGGCTT
AGCAACCCTGTACAGTGCAATGCTAGCTTGTACAACCAGCGCGTGCCTAGTTATATTGCCAACGCGCAAGACTTT
GATAATCTAGTCGCACATAATCAGGCCCTGGGTGAATCTTGCACTCAGATGACGGGCCCGGCCATTAATTTTTTA
GATACCGTTTCGGTAGCCAAGGACCTTGACCAGATACGACAGGCTCTTGGTGATGAGAAGCTAGACTTCTTGGGA
GTTTCTTATGGAACATTTTTGGGGAGCCAGTATGCAGAACTATTTCCCCAAAGGGTTGGCCGCATGGTTCTCGAC
GGCATCCTCGGGCATTCACAAAGCGATGCCGATGCCATGTTAACGGAAGCCACAACTTTCGAGGCCATGTTTAAT
AGCTTTGCTCGATTGTGCTACACAGCTCCCGAATGCGCCTTTTATCAACAAGACTTACCCTCCATCTTTGACCAA
ATGGTTGACGAGGCTAATGAGCAGCCAATCCCGGCTCCTGGCTGTCTTGTTCCCGCAGACGCGGCGACAAGAAAC
GAAAACAGCCAAGCCTGTCGGTCTGATGTCACGGGATATGAGCTTATAAGCAGCACACAAGGCCTCATGTCTAGC
CTAATCCCGTGGCCCGCCATCTCTCAAGCTTTAAAAGAGGCCTACGAGGGCAACGCGACATTGCTATCCTCGACA
CTCGTCACCTCCAATGTGCCCCCTATTGACCAAGACTACAACCCCTTTGCGCATATCGCCATTTCCTGCCAAGAC
TGGGTGCGCGGAACTGGACCTCGGGCCGCAGCAGATCTCATGGCCAAGCTGATTGCAGCTCGCGCTCTGGCTCCC
CATACGCGTGGCGTAACCGAAATGTTGAATATTCAAACAAGTTGCCTCGGCTGGCCGGCGCCCTTGGTAAATCCG
CAGCGACTGTTTAACCAGAAACAATTAGCCCAGGCTCCTCCGATTCTCCTCGTTAATGCGTTTCAAGACCCGTCA
ACAAGCATCGCATGGGCACTTGGCGTTCGGGAGCAAATGCCAACAGCAGTGAGCATATTTCGCAGTGGATACGGC
CATATAAGTTATTGGCACTATGGCGACACGCAGAAAGCTATTGATGGCTTCTTGCTCGATGGGGAAATGCCCGCG
GACCTTGCTATCTTTGAGTCGTGA
Gene >OphauB2|1483
ATGGACTACAATGCCCCCAAAGATGCTCAAAACTGCATTACCCTTGGCATGGTTCGCATCAAGTCAAATAACTCT
CAGCCCCTTGGAAACCTTATCGTTAACCCCGGCGGCCCTGGATATTCCCCTGTTAGTGCATTTGTTCTTCAACAG
CAAGATGCACTCGTCAGCGAAAACCTCATAAAGCACTACAATATAATCGCACCGGACCCTCGTGGTGTAGGGCTT
AGCAACCCTGTACAGTGCAATGCTAGCTTGTACAACCAGCGCGTGCCTAGTTATATTGCCAACGCGCAAGACTTT
GATAATCTAGTCGCACATAATCAGGCCCTGGGTGAATCTTGCACTCAGATGACGGGCCCGGCCATTAATTTTTTA
GATACCGTTTCGGTAGCCAAGGACCTTGACCAGATACGACAGGTAAATAACCGAGCCAAACGGCTATCTCATCTC
GATACATTTCCTTGGATATGGCTGACTATAGCCATCTACAGGCTCTTGGTGATGAGAAGCTAGACTTCTTGGGAG
TTTCTTATGGAACATTTTTGGGGAGCCAGTATGCAGAACTATTTCCCCAAAGGGTTGGCCGCATGGTTCTCGACG
GCATCCTCGGGCATTCACAAAGCGATGCCGATGCCATGTTAACGGAAGCCACAACTTTCGAGGCCATGTTTAATA
GCTTTGCTCGATTGTGCTACACAGCTCCCGAATGCGCCTTTTATCAACAAGACTTACCCTCCATCTTTGACCAAA
TGGTTGACGAGGCTAATGAGCAGCCAATCCCGGCTCCTGGCTGTCTTGTTCCCGCAGACGCGGCGACAAGAAACG
AAAACAGCCAAGCCTGTCGGTCTGATGTCACGGGATATGAGCTTATAAGCAGCACACAAGGCCTCATGTCTAGCC
TAATCCCGTGGCCCGCCATCTCTCAAGCTTTAAAAGAGGCCTACGAGGGCAACGCGACATTGCTATCCTCGACAC
TCGTCACCTCCAATGTGCCCCCTATTGACCAAGACTACAACCCCTTTGCGCATATCGCCATTTCCTGCCAAGACT
GGGTGCGCGGAACTGGACCTCGGGCCGCAGCAGATCTCATGGCCAAGCTGATTGCAGCTCGCGCTCTGGCTCCCC
ATACGCGTGGCGTAACCGAAATGTTGAATATTCAAACAAGTTGCCTCGGCTGGCCGGCGCCCTTGGTAAATCCGC
AGCGACTGTTTAACCAGAAACAATTAGCCCAGGCTCCTCCGATTCTCCTCGTTAATGCGTTTCAAGACCCGTCAA
CAAGCATCGCATGGGCACTTGGCGTTCGGGAGCAAATGCCAACAGCAGTGAGCATATTTCGCAGTGGATACGGCC
ATATAAGTTATTGGCACTATGGCGACACGCAGAAAGCTATTGATGGCTTCTTGCTCGATGGGGAAATGCCCGCGG
ACCTTGCTATCTTTGAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail