Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|148
Gene name
LocationContig_1:377984..379001
Strand-
Gene length (bp)1017
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 2.1E-14 66 295
PF13483 Lactamase_B_3 Beta-lactamase superfamily domain 3.8E-14 49 294

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B5YIH1|Y282_THEYD UPF0173 metal-dependent hydrolase THEYE_A0282 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=THEYE_A0282 PE=3 SV=1 56 332 5.0E-08
sp|O29003|Y1265_ARCFU UPF0173 metal-dependent hydrolase AF_1265 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1265 PE=3 SV=1 50 333 1.0E-06
sp|Q769K2|NAPEP_RAT N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D OS=Rattus norvegicus GN=Napepld PE=1 SV=1 43 118 8.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|148
MDAKHHLRFDPDNKPPLLKDQAGPQSGGRQPLGKVLCHPRGTSGVENATLTFIGTATTLIEWQGFRILTDPNFLH
AGDHVHLGPGVNATRRTNPALNLHELPPVDCILLSHYHEDHFDRLVEDSLHRQFPIVTTPHAKQCLTAAEAKDEP
FGQVTSLDVFESCMLHIGSGEQRAIRVTGMPGKHVPPGPLSAVNSVLKAIPPTNGWLVELGYPSTSQGLRVGYRI
YISGDTLFVHELQEIPKHLGNHQIDLMLVHLGGTTIPGESMPLIMVTMDGKQGMQLVRLIDADVTIPIHFDDYDA
FLSPLSDFEAEVDKAGYQHRVVYLDRGDSYRFTVGHEG*
Coding >OphauB2|148
ATGGACGCCAAACACCATTTGCGTTTTGATCCCGACAATAAGCCCCCCCTCCTCAAAGACCAGGCCGGGCCCCAA
TCGGGAGGCAGGCAGCCATTGGGAAAGGTATTGTGTCATCCTCGCGGGACAAGTGGTGTCGAGAATGCCACCCTC
ACCTTTATTGGCACCGCCACCACCTTGATCGAGTGGCAGGGCTTCCGCATCCTGACGGATCCAAACTTCCTCCAT
GCTGGCGACCACGTCCACCTGGGGCCCGGCGTCAATGCGACGCGCAGGACCAATCCGGCATTGAACCTGCACGAG
CTGCCGCCAGTCGACTGCATTCTGCTCTCGCATTATCACGAGGACCACTTTGACAGGCTGGTTGAGGACTCGCTG
CATCGCCAGTTCCCCATAGTCACCACGCCGCATGCCAAGCAGTGCCTGACTGCAGCCGAGGCCAAGGACGAGCCG
TTTGGCCAAGTGACAAGCCTCGACGTCTTTGAAAGCTGCATGTTGCATATTGGGTCGGGCGAGCAACGCGCCATC
AGGGTAACGGGCATGCCAGGCAAACACGTTCCCCCCGGGCCGCTCTCTGCTGTCAACAGCGTGCTCAAGGCCATT
CCGCCCACAAATGGGTGGCTGGTGGAGCTGGGCTATCCAAGCACCTCCCAAGGCTTGCGGGTTGGCTACCGCATC
TACATATCTGGCGACACCTTGTTCGTCCATGAGCTCCAGGAGATCCCGAAACACCTTGGCAACCATCAAATCGAC
CTGATGCTCGTCCACTTGGGCGGCACCACCATTCCGGGAGAGTCCATGCCCCTCATCATGGTGACAATGGATGGC
AAGCAGGGCATGCAACTGGTCCGTCTCATTGACGCCGACGTGACGATTCCAATCCACTTTGACGACTACGACGCC
TTTTTATCGCCCCTGTCCGACTTTGAAGCCGAGGTGGACAAGGCGGGCTATCAGCATCGAGTCGTCTATCTCGAT
CGGGGAGACTCGTATCGCTTTACCGTTGGCCACGAGGGCTGA
Transcript >OphauB2|148
ATGGACGCCAAACACCATTTGCGTTTTGATCCCGACAATAAGCCCCCCCTCCTCAAAGACCAGGCCGGGCCCCAA
TCGGGAGGCAGGCAGCCATTGGGAAAGGTATTGTGTCATCCTCGCGGGACAAGTGGTGTCGAGAATGCCACCCTC
ACCTTTATTGGCACCGCCACCACCTTGATCGAGTGGCAGGGCTTCCGCATCCTGACGGATCCAAACTTCCTCCAT
GCTGGCGACCACGTCCACCTGGGGCCCGGCGTCAATGCGACGCGCAGGACCAATCCGGCATTGAACCTGCACGAG
CTGCCGCCAGTCGACTGCATTCTGCTCTCGCATTATCACGAGGACCACTTTGACAGGCTGGTTGAGGACTCGCTG
CATCGCCAGTTCCCCATAGTCACCACGCCGCATGCCAAGCAGTGCCTGACTGCAGCCGAGGCCAAGGACGAGCCG
TTTGGCCAAGTGACAAGCCTCGACGTCTTTGAAAGCTGCATGTTGCATATTGGGTCGGGCGAGCAACGCGCCATC
AGGGTAACGGGCATGCCAGGCAAACACGTTCCCCCCGGGCCGCTCTCTGCTGTCAACAGCGTGCTCAAGGCCATT
CCGCCCACAAATGGGTGGCTGGTGGAGCTGGGCTATCCAAGCACCTCCCAAGGCTTGCGGGTTGGCTACCGCATC
TACATATCTGGCGACACCTTGTTCGTCCATGAGCTCCAGGAGATCCCGAAACACCTTGGCAACCATCAAATCGAC
CTGATGCTCGTCCACTTGGGCGGCACCACCATTCCGGGAGAGTCCATGCCCCTCATCATGGTGACAATGGATGGC
AAGCAGGGCATGCAACTGGTCCGTCTCATTGACGCCGACGTGACGATTCCAATCCACTTTGACGACTACGACGCC
TTTTTATCGCCCCTGTCCGACTTTGAAGCCGAGGTGGACAAGGCGGGCTATCAGCATCGAGTCGTCTATCTCGAT
CGGGGAGACTCGTATCGCTTTACCGTTGGCCACGAGGGCTGA
Gene >OphauB2|148
ATGGACGCCAAACACCATTTGCGTTTTGATCCCGACAATAAGCCCCCCCTCCTCAAAGACCAGGCCGGGCCCCAA
TCGGGAGGCAGGCAGCCATTGGGAAAGGTATTGTGTCATCCTCGCGGGACAAGTGGTGTCGAGAATGCCACCCTC
ACCTTTATTGGCACCGCCACCACCTTGATCGAGTGGCAGGGCTTCCGCATCCTGACGGATCCAAACTTCCTCCAT
GCTGGCGACCACGTCCACCTGGGGCCCGGCGTCAATGCGACGCGCAGGACCAATCCGGCATTGAACCTGCACGAG
CTGCCGCCAGTCGACTGCATTCTGCTCTCGCATTATCACGAGGACCACTTTGACAGGCTGGTTGAGGACTCGCTG
CATCGCCAGTTCCCCATAGTCACCACGCCGCATGCCAAGCAGTGCCTGACTGCAGCCGAGGCCAAGGACGAGCCG
TTTGGCCAAGTGACAAGCCTCGACGTCTTTGAAAGCTGCATGTTGCATATTGGGTCGGGCGAGCAACGCGCCATC
AGGGTAACGGGCATGCCAGGCAAACACGTTCCCCCCGGGCCGCTCTCTGCTGTCAACAGCGTGCTCAAGGCCATT
CCGCCCACAAATGGGTGGCTGGTGGAGCTGGGCTATCCAAGCACCTCCCAAGGCTTGCGGGTTGGCTACCGCATC
TACATATCTGGCGACACCTTGTTCGTCCATGAGCTCCAGGAGATCCCGAAACACCTTGGCAACCATCAAATCGAC
CTGATGCTCGTCCACTTGGGCGGCACCACCATTCCGGGAGAGTCCATGCCCCTCATCATGGTGACAATGGATGGC
AAGCAGGGCATGCAACTGGTCCGTCTCATTGACGCCGACGTGACGATTCCAATCCACTTTGACGACTACGACGCC
TTTTTATCGCCCCTGTCCGACTTTGAAGCCGAGGTGGACAAGGCGGGCTATCAGCATCGAGTCGTCTATCTCGAT
CGGGGAGACTCGTATCGCTTTACCGTTGGCCACGAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail