Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1468
Gene name
LocationContig_14:61665..65799
Strand-
Gene length (bp)4134
Transcript length (bp)4002
Coding sequence length (bp)4002
Protein length (aa) 1334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.2E-20 100 288
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 4.8E-20 100 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CY9|GDT8_DICDI Probable serine/threonine-protein kinase gdt8 OS=Dictyostelium discoideum GN=gdt8 PE=3 SV=1 112 289 4.0E-11
sp|Q9FIL7|CRCK1_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana GN=CRCK1 PE=1 SV=1 102 282 7.0E-11
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 135 282 7.0E-10
sp|Q9SI06|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2 101 284 9.0E-10
sp|Q55GE6|ROCO7_DICDI Probable serine/threonine-protein kinase roco7 OS=Dictyostelium discoideum GN=roco7 PE=3 SV=1 136 282 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CY9|GDT8_DICDI Probable serine/threonine-protein kinase gdt8 OS=Dictyostelium discoideum GN=gdt8 PE=3 SV=1 112 289 4.0E-11
sp|Q9FIL7|CRCK1_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana GN=CRCK1 PE=1 SV=1 102 282 7.0E-11
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 135 282 7.0E-10
sp|Q9SI06|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2 101 284 9.0E-10
sp|Q55GE6|ROCO7_DICDI Probable serine/threonine-protein kinase roco7 OS=Dictyostelium discoideum GN=roco7 PE=3 SV=1 136 282 1.0E-09
sp|C0LGL4|Y2289_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g28960 OS=Arabidopsis thaliana GN=At2g28960 PE=2 SV=1 136 282 1.0E-09
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 136 278 1.0E-09
sp|Q54XQ2|RCKA_DICDI RGS domain-containing serine/threonine-protein kinase A OS=Dictyostelium discoideum GN=rckA PE=1 SV=1 113 288 2.0E-09
sp|C0LGT5|Y5169_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana GN=At5g16900 PE=2 SV=1 101 284 2.0E-09
sp|Q8VZJ9|CRCK2_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 2 OS=Arabidopsis thaliana GN=CRCK2 PE=2 SV=1 116 282 2.0E-09
sp|Q9ASQ5|CRCK3_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 3 OS=Arabidopsis thaliana GN=CRCK3 PE=2 SV=1 136 282 4.0E-09
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 103 288 5.0E-09
sp|D7UPN3|CERK1_ORYSJ Chitin elicitor receptor kinase 1 OS=Oryza sativa subsp. japonica GN=CERK1 PE=1 SV=1 114 282 5.0E-09
sp|Q67E01|DUSTY_XENLA Dual serine/threonine and tyrosine protein kinase OS=Xenopus laevis GN=dstyk PE=2 SV=1 120 294 5.0E-09
sp|Q6XUX2|DUSTY_RAT Dual serine/threonine and tyrosine protein kinase OS=Rattus norvegicus GN=Dstyk PE=2 SV=1 120 294 6.0E-09
sp|P13406|FYN_XENLA Tyrosine-protein kinase Fyn OS=Xenopus laevis GN=fyn PE=2 SV=3 103 290 6.0E-09
sp|Q67E00|DUSTY_XENTR Dual serine/threonine and tyrosine protein kinase OS=Xenopus tropicalis GN=dstyk PE=2 SV=1 120 294 7.0E-09
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 103 290 8.0E-09
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 114 350 9.0E-09
sp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1 113 282 1.0E-08
sp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR2 OS=Arabidopsis thaliana GN=ANX2 PE=2 SV=1 103 282 1.0E-08
sp|Q6XUX1|DUSTY_MOUSE Dual serine/threonine and tyrosine protein kinase OS=Mus musculus GN=Dstyk PE=1 SV=1 120 294 1.0E-08
sp|Q4VSN5|DUSTY_PANTR Dual serine/threonine and tyrosine protein kinase OS=Pan troglodytes GN=DSTYK PE=2 SV=1 120 294 1.0E-08
sp|O64556|Y2923_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Arabidopsis thaliana GN=At2g19230 PE=3 SV=3 161 282 1.0E-08
sp|Q9LT96|Y5977_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1 120 385 1.0E-08
sp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1 161 282 1.0E-08
sp|Q20CR4|DUSTY_MACMU Dual serine/threonine and tyrosine protein kinase OS=Macaca mulatta GN=DSTYK PE=2 SV=1 120 294 2.0E-08
sp|Q4VSN4|DUSTY_CANLF Dual serine/threonine and tyrosine protein kinase OS=Canis lupus familiaris GN=DSTYK PE=2 SV=1 120 294 2.0E-08
sp|Q6XUX3|DUSTY_HUMAN Dual serine/threonine and tyrosine protein kinase OS=Homo sapiens GN=DSTYK PE=1 SV=2 120 294 2.0E-08
sp|C0LGG3|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1 136 284 2.0E-08
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 162 362 2.0E-08
sp|Q4TVR5|DUSTY_BOVIN Dual serine/threonine and tyrosine protein kinase OS=Bos taurus GN=DSTYK PE=2 SV=1 120 294 2.0E-08
sp|Q9FZB1|Y5188_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1 161 284 2.0E-08
sp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1 45 312 2.0E-08
sp|Q15569|TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens GN=TESK1 PE=1 SV=2 136 303 2.0E-08
sp|Q9FPR3|EDR1_ARATH Serine/threonine-protein kinase EDR1 OS=Arabidopsis thaliana GN=EDR1 PE=1 SV=1 116 278 2.0E-08
sp|P17713|STK_HYDVU Tyrosine-protein kinase STK OS=Hydra vulgaris GN=STK PE=2 SV=1 81 290 2.0E-08
sp|C0LGR6|Y4291_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2 161 278 3.0E-08
sp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=3 SV=1 162 278 3.0E-08
sp|Q54G43|SHKE_DICDI Dual specificity protein kinase shkE OS=Dictyostelium discoideum GN=shkE PE=3 SV=1 186 281 3.0E-08
sp|O70146|TESK1_MOUSE Dual specificity testis-specific protein kinase 1 OS=Mus musculus GN=Tesk1 PE=1 SV=3 136 303 5.0E-08
sp|A2CI35|DUSTY_STRPU Dual serine/threonine and tyrosine protein kinase OS=Strongylocentrotus purpuratus GN=DSTYK PE=2 SV=1 186 316 5.0E-08
sp|O22187|Y2232_ARATH Probable receptor-like protein kinase At2g23200 OS=Arabidopsis thaliana GN=At2g23200 PE=3 SV=1 113 316 6.0E-08
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 95 288 6.0E-08
sp|O42127|FGFR3_XENLA Fibroblast growth factor receptor 3 OS=Xenopus laevis GN=fgfr3 PE=2 SV=1 118 293 6.0E-08
sp|Q9FLJ8|Y5613_ARATH Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1 183 312 7.0E-08
sp|Q9FZB8|Y5181_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51810 OS=Arabidopsis thaliana GN=At1g51810 PE=2 SV=1 161 278 7.0E-08
sp|P39688|FYN_MOUSE Tyrosine-protein kinase Fyn OS=Mus musculus GN=Fyn PE=1 SV=4 103 290 8.0E-08
sp|Q05876|FYN_CHICK Tyrosine-protein kinase Fyn OS=Gallus gallus GN=FYN PE=1 SV=2 103 290 8.0E-08
sp|C0LGG4|Y1518_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51860 OS=Arabidopsis thaliana GN=At1g51860 PE=2 SV=2 161 284 9.0E-08
sp|Q9T020|Y4391_ARATH Probable receptor-like protein kinase At4g39110 OS=Arabidopsis thaliana GN=At4g39110 PE=3 SV=1 103 312 9.0E-08
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 135 278 9.0E-08
sp|Q6XUX0|DUSTY_CHICK Dual serine/threonine and tyrosine protein kinase OS=Gallus gallus GN=DSTYK PE=2 SV=1 120 278 1.0E-07
sp|P32577|CSK_RAT Tyrosine-protein kinase CSK OS=Rattus norvegicus GN=Csk PE=1 SV=1 103 293 1.0E-07
sp|Q6XHA5|ROC11_DICDI Probable serine/threonine-protein kinase roco11 OS=Dictyostelium discoideum GN=roco11 PE=3 SV=1 113 314 1.0E-07
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 997 1231 1.0E-07
sp|P14234|FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus GN=Fgr PE=1 SV=2 103 290 1.0E-07
sp|P41240|CSK_HUMAN Tyrosine-protein kinase CSK OS=Homo sapiens GN=CSK PE=1 SV=1 103 293 1.0E-07
sp|Q9SJT0|Y2214_ARATH Probable receptor-like protein kinase At2g21480 OS=Arabidopsis thaliana GN=At2g21480 PE=3 SV=1 103 312 1.0E-07
sp|P41241|CSK_MOUSE Tyrosine-protein kinase CSK OS=Mus musculus GN=Csk PE=1 SV=2 103 293 1.0E-07
sp|O65238|Y5537_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 OS=Arabidopsis thaliana GN=At5g35370 PE=2 SV=2 162 278 1.0E-07
sp|P06241|FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens GN=FYN PE=1 SV=3 103 290 1.0E-07
sp|Q4VSN1|DUSTY_DANRE Dual serine/threonine and tyrosine protein kinase OS=Danio rerio GN=dstyk PE=2 SV=1 120 316 1.0E-07
sp|A1Y2K1|FYN_PIG Tyrosine-protein kinase Fyn OS=Sus scrofa GN=FYN PE=2 SV=2 103 290 1.0E-07
sp|Q9SCZ4|FERON_ARATH Receptor-like protein kinase FERONIA OS=Arabidopsis thaliana GN=FER PE=1 SV=1 162 282 1.0E-07
sp|Q86HG9|Y9871_DICDI Probable serine/threonine-protein kinase DDB_G0271682 OS=Dictyostelium discoideum GN=DDB_G0271682 PE=3 SV=2 161 306 1.0E-07
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 136 282 1.0E-07
sp|Q62844|FYN_RAT Tyrosine-protein kinase Fyn OS=Rattus norvegicus GN=Fyn PE=1 SV=1 103 290 1.0E-07
sp|A0JNB0|FYN_BOVIN Tyrosine-protein kinase Fyn OS=Bos taurus GN=FYN PE=2 SV=1 103 290 2.0E-07
sp|Q9SNA3|Y3463_ARATH Putative receptor-like protein kinase At3g46340 OS=Arabidopsis thaliana GN=At3g46340 PE=3 SV=1 161 284 2.0E-07
sp|P27446|FYN_XIPHE Tyrosine-protein kinase Fyn OS=Xiphophorus helleri GN=fyn PE=2 SV=3 103 290 2.0E-07
sp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g59700 OS=Arabidopsis thaliana GN=At5g59700 PE=3 SV=1 77 282 2.0E-07
sp|Q09147|FGFR2_DROME Fibroblast growth factor receptor homolog 2 OS=Drosophila melanogaster GN=btl PE=2 SV=3 102 291 2.0E-07
sp|P34265|KIN31_CAEEL Probable tyrosine-protein kinase kin-31 OS=Caenorhabditis elegans GN=kin-31 PE=3 SV=4 103 290 2.0E-07
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 136 282 2.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 775 1225 2.0E-07
sp|Q9LFV3|Y5157_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 OS=Arabidopsis thaliana GN=At5g15730 PE=2 SV=1 162 291 2.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 775 1225 2.0E-07
sp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana GN=HERK1 PE=1 SV=1 103 282 2.0E-07
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 121 282 3.0E-07
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 121 282 3.0E-07
sp|Q9ZQR3|Y2451_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510 OS=Arabidopsis thaliana GN=At2g14510 PE=2 SV=1 97 278 3.0E-07
sp|C0LGV0|Y5487_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g48740 OS=Arabidopsis thaliana GN=At5g48740 PE=2 SV=1 162 278 3.0E-07
sp|Q4VSN3|DUSTY_TETNG Dual serine/threonine and tyrosine protein kinase OS=Tetraodon nigroviridis GN=dstyk PE=2 SV=1 120 294 3.0E-07
sp|Q63572|TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus GN=Tesk1 PE=1 SV=1 136 303 3.0E-07
sp|Q0VBZ0|CSK_BOVIN Tyrosine-protein kinase CSK OS=Bos taurus GN=CSK PE=2 SV=1 103 293 4.0E-07
sp|Q4VSN2|DUSTY_TAKRU Dual serine/threonine and tyrosine protein kinase OS=Takifugu rubripes GN=dstyk PE=2 SV=1 120 316 4.0E-07
sp|Q6EWH2|FYNA_DANRE Tyrosine-protein kinase fyna OS=Danio rerio GN=fyna PE=1 SV=2 103 290 4.0E-07
sp|Q9M9C5|Y1680_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g68400 OS=Arabidopsis thaliana GN=At1g68400 PE=2 SV=1 136 282 5.0E-07
sp|A1A5H8|YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio GN=yes1 PE=1 SV=1 103 290 5.0E-07
sp|Q8RY67|WAKLO_ARATH Wall-associated receptor kinase-like 14 OS=Arabidopsis thaliana GN=WAKL14 PE=2 SV=2 101 282 5.0E-07
sp|Q0GGW5|STK11_CHICK Serine/threonine-protein kinase STK11 OS=Gallus gallus GN=STK11 PE=2 SV=1 119 290 5.0E-07
sp|C0LGP2|MEE39_ARATH Probable LRR receptor-like serine/threonine-protein kinase MEE39 OS=Arabidopsis thaliana GN=MEE39 PE=2 SV=1 161 284 5.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 775 1225 5.0E-07
sp|P0C5E2|Y1839_ARATH Probable serine/threonine-protein kinase At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=2 SV=2 162 282 6.0E-07
sp|P42686|SRK1_SPOLA Tyrosine-protein kinase isoform SRK1 OS=Spongilla lacustris GN=SRK1 PE=2 SV=1 80 313 6.0E-07
sp|P24604|TEC_MOUSE Tyrosine-protein kinase Tec OS=Mus musculus GN=Tec PE=1 SV=2 75 285 6.0E-07
sp|D4AE59|STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus GN=Stk11 PE=1 SV=1 119 290 6.0E-07
sp|C0LGG6|Y5189_ARATH Probable LRR receptor-like protein kinase At1g51890 OS=Arabidopsis thaliana GN=At1g51890 PE=2 SV=2 161 284 7.0E-07
sp|Q9ZQQ7|Y2144_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 OS=Arabidopsis thaliana GN=At2g14440 PE=3 SV=1 97 282 7.0E-07
sp|Q9FX99|Y1497_ARATH Probable receptor-like protein kinase At1g49730 OS=Arabidopsis thaliana GN=At1g49730 PE=2 SV=1 140 278 7.0E-07
sp|Q9FLW0|Y5241_ARATH Probable receptor-like protein kinase At5g24010 OS=Arabidopsis thaliana GN=At5g24010 PE=1 SV=1 162 282 1.0E-06
sp|Q91604|STK11_XENLA Serine/threonine-protein kinase stk11 OS=Xenopus laevis GN=stk11 PE=1 SV=1 119 290 1.0E-06
sp|Q9SV05|CCR35_ARATH Serine/threonine-protein kinase-like protein At3g51990 OS=Arabidopsis thaliana GN=At3g51990 PE=2 SV=1 160 282 1.0E-06
sp|P27447|YES_XIPHE Tyrosine-protein kinase Yes OS=Xiphophorus helleri GN=yes PE=2 SV=3 103 290 1.0E-06
sp|A2CI34|DUSTY_PIMPR Dual serine/threonine and tyrosine protein kinase OS=Pimephales promelas GN=dstyk PE=2 SV=1 120 316 1.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 990 1225 1.0E-06
sp|Q15831|STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens GN=STK11 PE=1 SV=1 119 290 1.0E-06
sp|F1RDG9|FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio GN=fynb PE=2 SV=1 103 290 1.0E-06
sp|O80623|Y2393_ARATH Probable receptor-like protein kinase At2g39360 OS=Arabidopsis thaliana GN=At2g39360 PE=2 SV=1 96 282 1.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 934 1225 1.0E-06
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 963 1276 1.0E-06
sp|C0LGW2|PAM74_ARATH Probable LRR receptor-like serine/threonine-protein kinase PAM74 OS=Arabidopsis thaliana GN=PAM74 PE=2 SV=1 161 284 1.0E-06
sp|Q54WS5|ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum GN=roco6 PE=3 SV=1 136 288 1.0E-06
sp|Q54VC0|Y9865_DICDI Probable serine/threonine-protein kinase DDB_G0280461 OS=Dictyostelium discoideum GN=DDB_G0280461 PE=3 SV=1 124 278 2.0E-06
sp|Q8H1D6|RBK1_ARATH Receptor-like cytosolic serine/threonine-protein kinase RBK1 OS=Arabidopsis thaliana GN=RBK1 PE=1 SV=1 162 282 2.0E-06
sp|Q9WTK7|STK11_MOUSE Serine/threonine-protein kinase STK11 OS=Mus musculus GN=Stk11 PE=1 SV=1 119 290 2.0E-06
sp|Q2QLH6|MET_OTOGA Hepatocyte growth factor receptor OS=Otolemur garnettii GN=MET PE=3 SV=1 135 290 2.0E-06
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 157 282 2.0E-06
sp|Q00PJ8|MET_ATEAB Hepatocyte growth factor receptor OS=Atelerix albiventris GN=MET PE=3 SV=1 135 290 2.0E-06
sp|Q07E01|MET_ORNAN Hepatocyte growth factor receptor OS=Ornithorhynchus anatinus GN=MET PE=3 SV=1 135 290 2.0E-06
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 1006 1306 3.0E-06
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 58 288 4.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 990 1225 5.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 742 1219 5.0E-06
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 145 282 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1468
MDFSNSLTFRIRPEPAQGNEPVIAQQPPPANDQQSRCPNLASFLAICLSSPDEHLGLHPVLTNATPDLDDVSLRG
GSFDVRRVKASSFPPELSNELFRSREFVVVKHPRPSSTGTAALADVATELQVLRHAPIRSHANVIDLLAVMYHDA
GVAQQPVILPALVLEYAAFGSLKTFQEEGHGHSFEDKMKIAVDTARGIEALHACGIVHGDVKTSNMLVCKHATRG
FIVKVSDFGFSIAMSDPQLAGHTEIFCPPESYHGRLEPEHAKKLDVYCYGLLLHSVLKDGTAYYPQGPEVPMGTS
EDFTKIKVSGLMPSTLVLNVLLTGPGREAYPLLLLCKILLYSLQPEPKNRIHDMSTIVFYLSLLEGCGSNGTDSS
DKASSEKVAAMLETVTQARKGAGNGGASILSSLTTVIRAMLSTMPGQTLPADSDLARQFLTVVSTFTDTLLNNFI
TAAAKLEIPMFESVSAELRSRAQKQISQILQAPEQGAESQQQSFSVARLCQLLLDCAGLFTDTDASETLPGDSKQ
ALSKPQFSFFQGHNLIPDFSLVNRVFQKMPWSVQKAAVHGLTQLHNNTTESTAKSKAALSLASIHANGIGIESDV
DEASRLTLEAAALGNEDAQTIYINGFSSKEQTHPQGVDLNMWQEWLSKSAEAGNKVAQSRLRSLDSAALSTMSKT
LNEKEFTTAAGTTLEQGQGLCAIVTDDTPNNQLKGILLSAIIEDERDVVDKCLERDEGLLLTRYNNGEHALLIAC
RLKSVEAAQSLVSPENANLGDDQGVRPLHWLSRDSEHYESLAKLLIDNGADINAIGPALYRSDHEQRVQIGRARW
TPLHWAVAFDNKAAIVSLLSLGCDATLRAEPDRGTWDLSALELASSLCHSSALAALLTSEAVKSQVDKPRPMVDG
LPVYITPLFYVLSSRSRWERIRQHGMCFEQKTRETISLLVEHGARTDRVLQSRDANMPAAFATAYHACCADVMAS
GLKLGFGKDIEATCGALSSGGSALFLAITHRDRAMFTALVEAGARLSACDRDGMTPLHRAAKENDDVFFARALLD
AGVAADSDAEAPLPSPFQVAVFCRNYNVAKLLFDAGANRHRMGPKHHRTILGDMLMMHTWNSLERVKFLLDLPDA
PDGSDGFIGARADDQDVSVLHLAASHVHEASGRADNITTILMTQLLHKYNQKQHLDSTCGPFNMTALAVAVEVGD
HGVVRKLLEAGADANVPDRLGRVPLDLVYRRYCFPENLPTFDEVDGEDKMAVARALSAVNENTGEVLSLLKSYGA
EARTFYFPLWHQTDSGYRDAVWVMERLKEKKDKGAAPTASSTQDTESPLAGKLPQARD*
Coding >OphauB2|1468
ATGGACTTTTCCAACTCGCTCACCTTTCGCATTCGCCCCGAGCCGGCTCAAGGCAACGAGCCGGTAATAGCGCAG
CAACCCCCCCCAGCCAATGACCAGCAGTCCCGGTGTCCCAATCTGGCCTCTTTTCTCGCAATATGCTTATCCAGC
CCAGACGAGCACCTCGGTCTCCATCCAGTCCTTACCAACGCAACGCCCGACCTCGACGACGTCTCCCTCCGCGGC
GGCTCCTTTGACGTGCGCCGCGTCAAAGCCTCCTCCTTTCCCCCCGAGCTATCCAACGAGCTTTTCCGCTCCCGT
GAATTCGTCGTCGTCAAGCATCCCCGCCCCAGCTCCACCGGCACAGCCGCATTAGCCGACGTTGCGACGGAGCTG
CAGGTGCTTCGGCACGCGCCTATTCGCAGCCATGCAAATGTAATTGACTTGCTGGCCGTCATGTATCACGATGCG
GGTGTTGCGCAGCAGCCTGTTATTCTGCCGGCCCTGGTGCTCGAGTACGCGGCATTTGGCAGCTTGAAGACATTC
CAGGAGGAGGGACACGGGCACTCGTTTGAGGATAAGATGAAGATTGCAGTCGACACTGCGAGGGGCATCGAGGCG
TTGCATGCATGTGGCATTGTCCATGGCGATGTAAAGACGTCCAATATGCTCGTGTGCAAGCATGCTACGCGCGGC
TTCATCGTCAAGGTGTCTGACTTTGGTTTTTCCATTGCCATGAGCGACCCGCAACTTGCTGGGCACACTGAAATA
TTCTGCCCTCCAGAGTCGTACCATGGCCGCTTGGAGCCCGAGCATGCCAAGAAATTGGATGTCTACTGCTACGGC
CTCCTCCTGCATTCAGTCCTCAAAGACGGCACGGCATACTACCCCCAAGGCCCCGAGGTTCCAATGGGGACATCG
GAAGATTTCACCAAGATCAAGGTATCAGGCCTGATGCCATCCACGCTGGTTCTCAATGTTCTCCTCACTGGGCCG
GGCCGAGAAGCTTATCCGCTGCTTCTTCTCTGCAAGATTCTCTTGTACTCCCTGCAACCGGAGCCAAAGAACCGG
ATTCACGACATGTCCACCATTGTATTTTATCTCAGCCTTCTTGAAGGCTGTGGCAGTAATGGTACGGATTCCTCT
GACAAGGCGTCGTCGGAAAAAGTCGCTGCCATGCTTGAGACTGTGACACAAGCAAGAAAAGGGGCTGGGAATGGA
GGAGCTAGCATCTTGTCGAGTCTGACAACAGTCATTCGCGCCATGTTGTCAACCATGCCAGGGCAAACTCTGCCA
GCTGACTCGGACCTTGCTCGCCAATTTCTCACAGTGGTGTCGACATTTACGGATACGCTGCTCAACAACTTCATC
ACCGCGGCGGCCAAATTGGAGATTCCCATGTTTGAATCCGTCTCAGCTGAGCTGCGGTCGAGGGCCCAGAAACAG
ATATCTCAAATATTACAGGCCCCAGAGCAAGGCGCCGAGTCGCAGCAGCAAAGCTTTTCGGTGGCTCGGCTATGC
CAATTGCTCCTCGACTGTGCTGGATTGTTTACGGATACTGACGCCTCGGAGACTCTGCCGGGCGACTCGAAACAG
GCTTTGTCGAAGCCTCAATTCTCCTTTTTTCAAGGTCACAATCTCATTCCTGACTTCTCTCTTGTGAACCGAGTC
TTTCAAAAGATGCCGTGGTCAGTACAAAAAGCCGCGGTTCATGGCTTAACGCAGCTGCACAACAACACGACAGAA
TCGACCGCCAAGAGCAAGGCTGCGCTTAGCCTAGCGAGTATTCATGCCAACGGCATCGGGATTGAATCCGACGTG
GACGAGGCCTCGAGGCTCACCCTCGAAGCGGCAGCGCTGGGAAATGAAGACGCGCAAACAATTTACATTAATGGC
TTTTCTTCAAAAGAGCAAACGCATCCCCAAGGTGTGGATTTAAATATGTGGCAAGAATGGCTTAGCAAGTCGGCC
GAGGCTGGCAACAAAGTGGCTCAGTCTAGGTTGCGCAGCTTGGACTCGGCTGCGCTCTCCACCATGAGCAAAACT
CTCAATGAAAAAGAATTTACAACAGCCGCCGGTACTACCCTGGAGCAAGGACAAGGTCTCTGCGCCATTGTTACT
GACGATACTCCCAACAATCAGCTCAAGGGCATTTTGCTCAGTGCAATTATTGAGGATGAGAGGGATGTAGTTGAC
AAGTGTCTCGAGCGCGATGAAGGCCTGCTCCTTACCCGATACAACAATGGCGAACATGCTCTATTAATTGCATGC
AGGCTGAAAAGTGTAGAGGCGGCACAATCTCTAGTATCCCCGGAAAACGCAAACCTCGGCGACGACCAAGGAGTG
CGTCCTCTGCACTGGCTAAGCCGTGACTCAGAACACTACGAGAGCCTGGCAAAGCTCCTGATTGACAATGGCGCC
GATATCAATGCCATTGGCCCTGCCCTCTACCGATCAGACCATGAACAGCGAGTCCAGATTGGGCGAGCTAGATGG
ACTCCGCTACACTGGGCCGTCGCATTTGATAACAAGGCTGCCATAGTTTCTCTACTCAGTCTTGGATGCGATGCC
ACTCTACGCGCCGAACCGGATAGAGGAACATGGGACCTGAGTGCCCTCGAACTGGCCTCCAGCCTCTGCCATTCA
TCGGCCCTTGCAGCACTGCTGACCAGCGAGGCAGTCAAGTCTCAGGTCGACAAGCCACGGCCAATGGTGGATGGC
CTACCCGTGTATATAACGCCGCTATTCTACGTCTTGTCATCGAGGTCTCGCTGGGAAAGGATAAGACAACATGGC
ATGTGCTTTGAGCAAAAGACACGTGAGACTATATCACTTCTTGTTGAGCACGGCGCAAGGACAGATCGAGTGCTC
CAGAGCCGCGATGCCAATATGCCGGCAGCCTTTGCCACGGCCTATCACGCATGCTGCGCCGACGTCATGGCGTCT
GGTCTCAAGCTCGGCTTCGGCAAGGACATTGAGGCTACTTGCGGCGCCTTGTCAAGCGGAGGATCAGCGCTGTTT
CTCGCCATTACGCATCGCGACCGCGCCATGTTTACTGCCCTGGTCGAAGCTGGTGCAAGACTCTCTGCTTGTGAT
AGGGATGGCATGACGCCTTTGCATCGCGCCGCAAAGGAGAATGACGACGTCTTTTTTGCTCGCGCTCTCCTTGAC
GCGGGCGTTGCTGCCGACTCTGACGCCGAGGCACCGCTACCCAGTCCCTTTCAAGTTGCTGTATTCTGCCGCAAC
TACAACGTTGCCAAGCTGCTTTTTGACGCGGGTGCTAACCGCCATCGCATGGGGCCCAAACACCACAGGACTATT
CTCGGCGACATGCTCATGATGCATACATGGAACTCGCTAGAGCGCGTGAAATTCCTACTTGATTTGCCCGACGCA
CCTGATGGCTCCGACGGCTTCATAGGCGCGCGGGCCGACGACCAAGACGTCTCGGTATTGCACCTCGCGGCATCT
CATGTGCACGAGGCGTCTGGCCGAGCTGATAATATTACAACCATTCTCATGACCCAGCTACTCCACAAGTATAAC
CAAAAGCAGCACCTAGACTCAACCTGCGGCCCATTCAACATGACGGCACTGGCAGTGGCTGTCGAGGTTGGCGAC
CATGGCGTGGTGCGCAAGCTGCTCGAGGCTGGGGCTGATGCAAACGTGCCCGATAGGCTTGGCCGCGTGCCGCTC
GACTTGGTATACCGGAGATACTGCTTCCCTGAAAACTTGCCAACCTTTGACGAGGTGGATGGAGAGGATAAGATG
GCGGTTGCTCGGGCACTGAGTGCGGTGAATGAGAATACGGGAGAGGTGCTCTCGCTGCTAAAGAGTTATGGGGCA
GAGGCTAGGACGTTTTACTTTCCTCTCTGGCATCAGACTGACTCTGGGTATCGCGATGCTGTGTGGGTTATGGAG
CGTCTCAAGGAAAAGAAGGATAAGGGTGCAGCGCCGACTGCATCTTCAACTCAAGACACTGAATCTCCCTTGGCG
GGAAAATTGCCTCAAGCAAGAGATTAA
Transcript >OphauB2|1468
ATGGACTTTTCCAACTCGCTCACCTTTCGCATTCGCCCCGAGCCGGCTCAAGGCAACGAGCCGGTAATAGCGCAG
CAACCCCCCCCAGCCAATGACCAGCAGTCCCGGTGTCCCAATCTGGCCTCTTTTCTCGCAATATGCTTATCCAGC
CCAGACGAGCACCTCGGTCTCCATCCAGTCCTTACCAACGCAACGCCCGACCTCGACGACGTCTCCCTCCGCGGC
GGCTCCTTTGACGTGCGCCGCGTCAAAGCCTCCTCCTTTCCCCCCGAGCTATCCAACGAGCTTTTCCGCTCCCGT
GAATTCGTCGTCGTCAAGCATCCCCGCCCCAGCTCCACCGGCACAGCCGCATTAGCCGACGTTGCGACGGAGCTG
CAGGTGCTTCGGCACGCGCCTATTCGCAGCCATGCAAATGTAATTGACTTGCTGGCCGTCATGTATCACGATGCG
GGTGTTGCGCAGCAGCCTGTTATTCTGCCGGCCCTGGTGCTCGAGTACGCGGCATTTGGCAGCTTGAAGACATTC
CAGGAGGAGGGACACGGGCACTCGTTTGAGGATAAGATGAAGATTGCAGTCGACACTGCGAGGGGCATCGAGGCG
TTGCATGCATGTGGCATTGTCCATGGCGATGTAAAGACGTCCAATATGCTCGTGTGCAAGCATGCTACGCGCGGC
TTCATCGTCAAGGTGTCTGACTTTGGTTTTTCCATTGCCATGAGCGACCCGCAACTTGCTGGGCACACTGAAATA
TTCTGCCCTCCAGAGTCGTACCATGGCCGCTTGGAGCCCGAGCATGCCAAGAAATTGGATGTCTACTGCTACGGC
CTCCTCCTGCATTCAGTCCTCAAAGACGGCACGGCATACTACCCCCAAGGCCCCGAGGTTCCAATGGGGACATCG
GAAGATTTCACCAAGATCAAGGTATCAGGCCTGATGCCATCCACGCTGGTTCTCAATGTTCTCCTCACTGGGCCG
GGCCGAGAAGCTTATCCGCTGCTTCTTCTCTGCAAGATTCTCTTGTACTCCCTGCAACCGGAGCCAAAGAACCGG
ATTCACGACATGTCCACCATTGTATTTTATCTCAGCCTTCTTGAAGGCTGTGGCAGTAATGGTACGGATTCCTCT
GACAAGGCGTCGTCGGAAAAAGTCGCTGCCATGCTTGAGACTGTGACACAAGCAAGAAAAGGGGCTGGGAATGGA
GGAGCTAGCATCTTGTCGAGTCTGACAACAGTCATTCGCGCCATGTTGTCAACCATGCCAGGGCAAACTCTGCCA
GCTGACTCGGACCTTGCTCGCCAATTTCTCACAGTGGTGTCGACATTTACGGATACGCTGCTCAACAACTTCATC
ACCGCGGCGGCCAAATTGGAGATTCCCATGTTTGAATCCGTCTCAGCTGAGCTGCGGTCGAGGGCCCAGAAACAG
ATATCTCAAATATTACAGGCCCCAGAGCAAGGCGCCGAGTCGCAGCAGCAAAGCTTTTCGGTGGCTCGGCTATGC
CAATTGCTCCTCGACTGTGCTGGATTGTTTACGGATACTGACGCCTCGGAGACTCTGCCGGGCGACTCGAAACAG
GCTTTGTCGAAGCCTCAATTCTCCTTTTTTCAAGGTCACAATCTCATTCCTGACTTCTCTCTTGTGAACCGAGTC
TTTCAAAAGATGCCGTGGTCAGTACAAAAAGCCGCGGTTCATGGCTTAACGCAGCTGCACAACAACACGACAGAA
TCGACCGCCAAGAGCAAGGCTGCGCTTAGCCTAGCGAGTATTCATGCCAACGGCATCGGGATTGAATCCGACGTG
GACGAGGCCTCGAGGCTCACCCTCGAAGCGGCAGCGCTGGGAAATGAAGACGCGCAAACAATTTACATTAATGGC
TTTTCTTCAAAAGAGCAAACGCATCCCCAAGGTGTGGATTTAAATATGTGGCAAGAATGGCTTAGCAAGTCGGCC
GAGGCTGGCAACAAAGTGGCTCAGTCTAGGTTGCGCAGCTTGGACTCGGCTGCGCTCTCCACCATGAGCAAAACT
CTCAATGAAAAAGAATTTACAACAGCCGCCGGTACTACCCTGGAGCAAGGACAAGGTCTCTGCGCCATTGTTACT
GACGATACTCCCAACAATCAGCTCAAGGGCATTTTGCTCAGTGCAATTATTGAGGATGAGAGGGATGTAGTTGAC
AAGTGTCTCGAGCGCGATGAAGGCCTGCTCCTTACCCGATACAACAATGGCGAACATGCTCTATTAATTGCATGC
AGGCTGAAAAGTGTAGAGGCGGCACAATCTCTAGTATCCCCGGAAAACGCAAACCTCGGCGACGACCAAGGAGTG
CGTCCTCTGCACTGGCTAAGCCGTGACTCAGAACACTACGAGAGCCTGGCAAAGCTCCTGATTGACAATGGCGCC
GATATCAATGCCATTGGCCCTGCCCTCTACCGATCAGACCATGAACAGCGAGTCCAGATTGGGCGAGCTAGATGG
ACTCCGCTACACTGGGCCGTCGCATTTGATAACAAGGCTGCCATAGTTTCTCTACTCAGTCTTGGATGCGATGCC
ACTCTACGCGCCGAACCGGATAGAGGAACATGGGACCTGAGTGCCCTCGAACTGGCCTCCAGCCTCTGCCATTCA
TCGGCCCTTGCAGCACTGCTGACCAGCGAGGCAGTCAAGTCTCAGGTCGACAAGCCACGGCCAATGGTGGATGGC
CTACCCGTGTATATAACGCCGCTATTCTACGTCTTGTCATCGAGGTCTCGCTGGGAAAGGATAAGACAACATGGC
ATGTGCTTTGAGCAAAAGACACGTGAGACTATATCACTTCTTGTTGAGCACGGCGCAAGGACAGATCGAGTGCTC
CAGAGCCGCGATGCCAATATGCCGGCAGCCTTTGCCACGGCCTATCACGCATGCTGCGCCGACGTCATGGCGTCT
GGTCTCAAGCTCGGCTTCGGCAAGGACATTGAGGCTACTTGCGGCGCCTTGTCAAGCGGAGGATCAGCGCTGTTT
CTCGCCATTACGCATCGCGACCGCGCCATGTTTACTGCCCTGGTCGAAGCTGGTGCAAGACTCTCTGCTTGTGAT
AGGGATGGCATGACGCCTTTGCATCGCGCCGCAAAGGAGAATGACGACGTCTTTTTTGCTCGCGCTCTCCTTGAC
GCGGGCGTTGCTGCCGACTCTGACGCCGAGGCACCGCTACCCAGTCCCTTTCAAGTTGCTGTATTCTGCCGCAAC
TACAACGTTGCCAAGCTGCTTTTTGACGCGGGTGCTAACCGCCATCGCATGGGGCCCAAACACCACAGGACTATT
CTCGGCGACATGCTCATGATGCATACATGGAACTCGCTAGAGCGCGTGAAATTCCTACTTGATTTGCCCGACGCA
CCTGATGGCTCCGACGGCTTCATAGGCGCGCGGGCCGACGACCAAGACGTCTCGGTATTGCACCTCGCGGCATCT
CATGTGCACGAGGCGTCTGGCCGAGCTGATAATATTACAACCATTCTCATGACCCAGCTACTCCACAAGTATAAC
CAAAAGCAGCACCTAGACTCAACCTGCGGCCCATTCAACATGACGGCACTGGCAGTGGCTGTCGAGGTTGGCGAC
CATGGCGTGGTGCGCAAGCTGCTCGAGGCTGGGGCTGATGCAAACGTGCCCGATAGGCTTGGCCGCGTGCCGCTC
GACTTGGTATACCGGAGATACTGCTTCCCTGAAAACTTGCCAACCTTTGACGAGGTGGATGGAGAGGATAAGATG
GCGGTTGCTCGGGCACTGAGTGCGGTGAATGAGAATACGGGAGAGGTGCTCTCGCTGCTAAAGAGTTATGGGGCA
GAGGCTAGGACGTTTTACTTTCCTCTCTGGCATCAGACTGACTCTGGGTATCGCGATGCTGTGTGGGTTATGGAG
CGTCTCAAGGAAAAGAAGGATAAGGGTGCAGCGCCGACTGCATCTTCAACTCAAGACACTGAATCTCCCTTGGCG
GGAAAATTGCCTCAAGCAAGAGATTAA
Gene >OphauB2|1468
ATGGACTTTTCCAACTCGCTCACCTTTCGCATTCGCCCCGAGCCGGCTCAAGGCAACGAGCCGGTAATAGCGCAG
CAACCCCCCCCAGCCAATGACCAGCAGTCCCGGTGTCCCAATCTGGCCTCTTTTCTCGCAATATGCTTATCCAGC
CCAGACGAGCACCTCGGTCTCCATCCAGTCCTTACCAACGCAACGCCCGACCTCGACGACGTCTCCCTCCGCGGC
GGCTCCTTTGACGTGCGCCGCGTCAAAGCCTCCTCCTTTCCCCCCGAGCTATCCAACGAGCTTTTCCGCTCCCGT
GAATTCGTCGTCGTCAAGCATCCCCGCCCCAGCTCCACCGGCACAGCCGCATTAGCCGACGTTGCGACGGAGCTG
CAGGTGCTTCGGCACGCGCCTATTCGCAGCCATGCAAATGTAATTGACTTGCTGGCCGTCATGTATCACGATGCG
GGTGTTGCGCAGCAGCCTGTTATTCTGCCGGCCCTGGTGCTCGAGTACGCGGCATTTGGCAGCTTGAAGACATTC
CAGGAGGAGGGACACGGGCACTCGTTTGAGGATAAGATGAAGATTGCAGTCGACACTGCGAGGGGCATCGAGGCG
TTGCATGCATGTGGCATTGTCCATGGCGATGTAAAGACGTCCAATATGCTCGTGTGCAAGCATGCTACGCGCGGC
TTCATCGTCAAGGTGTCTGACTTTGGTTTTTCCATTGCCATGAGCGACCCGCAACTTGCTGGGCACACTGAAATA
TTCTGCCCTCCAGAGTCGTACCATGGCCGCTTGGAGCCCGAGCATGCCAAGAAATTGGATGTCTACTGCTACGGC
CTCCTCCTGCATTCAGTCCTCAAAGACGGCACGGCATACTACCCCCAAGGCCCCGAGGTTCCAATGGGGACATCG
GAAGATTTCACCAAGATCAAGGTATCAGGCCTGATGCCATCCACGCTGGTTCTCAATGTTCTCCTCACTGGGCCG
GGCCGAGAAGCTTATCCGCTGCTTCTTCTCTGCAAGATTCTCTTGTACTCCCTGCAACCGGAGCCAAAGAACCGG
ATTCACGACATGTCCACCATTGTATTTTATCTCAGCCTTCTTGAAGGCTGTGGCAGTAATGGTACGGATTCCTCT
GACAAGGCGTCGTCGGAAAAAGTCGCTGCCATGCTTGAGACTGTGACACAAGCAAGAAAAGGGGCTGGGAATGGA
GGAGCTAGCATCTTGTCGAGTCTGACAACAGTCATTCGCGCCATGTTGTCAACCATGCCAGGGCAAACTCTGCCA
GCTGACTCGGACCTTGCTCGCCAATTTCTCACAGTGGTGTCGACATTTACGGATACGCTGCTCAACAACTTCATC
ACCGCGGCGGCCAAATTGGAGATTCCCATGTTTGAATCCGTCTCAGCTGAGCTGCGGTCGAGGGCCCAGAAACAG
ATATCTCAAATATTACAGGCCCCAGAGCAAGGCGCCGAGTCGCAGCAGCAAAGCTTTTCGGTGGCTCGGCTATGC
CAATTGCTCCTCGACTGTGCTGGATTGTTTACGGATACTGACGCCTCGGAGACTCTGCCGGGCGACTCGTACGTG
TCTTTCTTTGCTCCATGCGAGGCTTATTTTTCATAATTGACGCTTGATTTAGGAAACAGGCTTTGTCGAAGCCTC
AATTCTCCTTTTTTCAAGGTCACAATCTCATTCCTGACGTGAGTATCATGAACAAGAGCTCTTTTTCTTTTCTCA
TGTCTAGTGCCTGTTTTTTTCTGACACAAAACTCAGTTCTCTCTTGTGAACCGAGTCTTTCAAAAGATGCCGTGG
TCAGTACAAAAAGCCGCGGTTCATGGCTTAACGCAGCTGCACAACAACACGACAGAATCGACCGCCAAGAGCAAG
GCTGCGCTTAGCCTAGCGAGTATTCATGCCAACGGCATCGGGATTGAATCCGACGTGGACGAGGCCTCGAGGCTC
ACCCTCGAAGCGGCAGCGCTGGGAAATGAAGACGCGCAAACAATTTACATTAATGGCTTTTCTTCAAAAGAGCAA
ACGCATCCCCAAGGTGTGGATTTAAATATGTGGCAAGAATGGCTTAGCAAGTCGGCCGAGGCTGGCAACAAAGTG
GCTCAGTCTAGGTTGCGCAGCTTGGACTCGGCTGCGCTCTCCACCATGAGCAAAACTCTCAATGAAAAAGAATTT
ACAACAGCCGCCGGTACTACCCTGGAGCAAGGACAAGGTCTCTGCGCCATTGTTACTGACGATACTCCCAACAAT
CAGCTCAAGGGCATTTTGCTCAGTGCAATTATTGAGGATGAGAGGGATGTAGTTGACAAGTGTCTCGAGCGCGAT
GAAGGCCTGCTCCTTACCCGATACAACAATGGCGAACATGCTCTATTAATTGCATGCAGGCTGAAAAGTGTAGAG
GCGGCACAATCTCTAGTATCCCCGGAAAACGCAAACCTCGGCGACGACCAAGGAGTGCGTCCTCTGCACTGGCTA
AGCCGTGACTCAGAACACTACGAGAGCCTGGCAAAGCTCCTGATTGACAATGGCGCCGATATCAATGCCATTGGC
CCTGCCCTCTACCGATCAGACCATGAACAGCGAGTCCAGATTGGGCGAGCTAGATGGACTCCGCTACACTGGGCC
GTCGCATTTGATAACAAGGCTGCCATAGTTTCTCTACTCAGTCTTGGATGCGATGCCACTCTACGCGCCGAACCG
GATAGAGGAACATGGGACCTGAGTGCCCTCGAACTGGCCTCCAGCCTCTGCCATTCATCGGCCCTTGCAGCACTG
CTGACCAGCGAGGCAGTCAAGTCTCAGGTCGACAAGCCACGGCCAATGGTGGATGGCCTACCCGTGTATATAACG
CCGCTATTCTACGTCTTGTCATCGAGGTCTCGCTGGGAAAGGATAAGACAACATGGCATGTGCTTTGAGCAAAAG
ACACGTGAGACTATATCACTTCTTGTTGAGCACGGCGCAAGGACAGATCGAGTGCTCCAGAGCCGCGATGCCAAT
ATGCCGGCAGCCTTTGCCACGGCCTATCACGCATGCTGCGCCGACGTCATGGCGTCTGGTCTCAAGCTCGGCTTC
GGCAAGGACATTGAGGCTACTTGCGGCGCCTTGTCAAGCGGAGGATCAGCGCTGTTTCTCGCCATTACGCATCGC
GACCGCGCCATGTTTACTGCCCTGGTCGAAGCTGGTGCAAGACTCTCTGCTTGTGATAGGGATGGCATGACGCCT
TTGCATCGCGCCGCAAAGGAGAATGACGACGTCTTTTTTGCTCGCGCTCTCCTTGACGCGGGCGTTGCTGCCGAC
TCTGACGCCGAGGCACCGCTACCCAGTCCCTTTCAAGTTGCTGTATTCTGCCGCAACTACAACGTTGCCAAGCTG
CTTTTTGACGCGGGTGCTAACCGCCATCGCATGGGGCCCAAACACCACAGGACTATTCTCGGCGACATGCTCATG
ATGCATACATGGAACTCGCTAGAGCGCGTGAAATTCCTACTTGATTTGCCCGACGCACCTGATGGCTCCGACGGC
TTCATAGGCGCGCGGGCCGACGACCAAGACGTCTCGGTATTGCACCTCGCGGCATCTCATGTGCACGAGGCGTCT
GGCCGAGCTGATAATATTACAACCATTCTCATGACCCAGCTACTCCACAAGTATAACCAAAAGCAGCACCTAGAC
TCAACCTGCGGCCCATTCAACATGACGGCACTGGCAGTGGCTGTCGAGGTTGGCGACCATGGCGTGGTGCGCAAG
CTGCTCGAGGCTGGGGCTGATGCAAACGTGCCCGATAGGCTTGGCCGCGTGCCGCTCGACTTGGTATACCGGAGA
TACTGCTTCCCTGAAAACTTGCCAACCTTTGACGAGGTGGATGGAGAGGATAAGATGGCGGTTGCTCGGGCACTG
AGTGCGGTGAATGAGAATACGGGAGAGGTGCTCTCGCTGCTAAAGAGTTATGGGGCAGAGGCTAGGACGTTTTAC
TTTCCTCTCTGGCATCAGACTGACTCTGGGTATCGCGATGCTGTGTGGGTTATGGAGCGTCTCAAGGAAAAGAAG
GATAAGGGTGCAGCGCCGACTGCATCTTCAACTCAAGACACTGAATCTCCCTTGGCGGGAAAATTGCCTCAAGCA
AGAGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail