Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|1463
Gene name
LocationContig_14:49121..50189
Strand+
Gene length (bp)1068
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20246 DUF6601 Family of unknown function (DUF6601) 5.3E-77 63 300

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 222 241 19
2 254 276 22
3 300 322 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup798
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|876
Ophiocordyceps australis map64 (Brazil) OphauB2|1463 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02782
Ophiocordyceps camponoti-rufipedis Ophun1|4817
Ophiocordyceps kimflemingae Ophio5|8329
Ophiocordyceps subramaniannii Hirsu2|3480
Ophiocordyceps subramaniannii Hirsu2|8260

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|1463
MATSTAKPPFGKHVTPIINGNFQSRSQPTTPRLAKPPVLPFYDSITPTLYLKQTSLIPIHTAKEYLQQSFDLERL
HRVQKWLWLAGLPLPARSLHRQKILGREIVITEQADMHLTWRESTLFLKPLWKPLLDYAFWEEALCHGDPAVYQS
AAGLVLSYTWLIASKPDLQIAKQHKLVPKKLKWEVWAAFVRDFLKTHNLHNFDSLVAARYDYGDLRLNRLNLIYR
FAPELFPTYLMRGYFYGYNRYSQFFGRNFAWAAVAVLYVGVVLAAMQVAGTVNPLKDDETFQRAAFGFSVFTMVA
MVFFSGVALGYFVVMFTLNLIFTKARVKEKARLKQCQSTAPTSDARECREGENLV*
Coding >OphauB2|1463
ATGGCGACATCGACTGCGAAGCCTCCTTTTGGGAAACATGTCACGCCAATCATCAACGGAAATTTTCAAAGCCGA
TCCCAACCGACCACGCCTCGTCTGGCCAAGCCTCCAGTGCTACCATTTTATGACAGCATCACGCCAACTCTTTAC
CTCAAGCAAACAAGTCTCATTCCCATCCACACCGCCAAGGAATACCTCCAACAGTCGTTCGACCTGGAGCGCCTT
CACCGCGTGCAAAAGTGGCTGTGGCTGGCCGGCCTGCCCCTTCCAGCGCGGTCCCTCCACAGGCAAAAGATTCTG
GGTCGCGAGATTGTGATAACGGAGCAGGCCGACATGCATCTCACCTGGCGCGAATCCACGCTTTTCCTCAAGCCT
CTCTGGAAACCACTACTCGACTACGCCTTCTGGGAAGAAGCGCTCTGCCATGGCGACCCAGCGGTTTACCAAAGC
GCGGCCGGCCTTGTACTCTCTTACACCTGGCTCATTGCTTCAAAGCCAGACTTGCAGATTGCGAAGCAGCACAAG
CTGGTTCCCAAGAAGCTCAAGTGGGAGGTCTGGGCCGCGTTTGTCCGCGACTTTTTAAAGACGCACAACTTGCAC
AACTTTGATTCACTCGTCGCCGCACGCTACGACTATGGTGATTTGCGACTTAATCGTCTCAACCTCATCTACCGC
TTCGCCCCCGAGTTATTCCCCACGTATCTTATGCGAGGGTATTTCTACGGCTACAACAGGTATAGCCAATTCTTT
GGACGCAATTTTGCCTGGGCCGCCGTGGCCGTCTTGTATGTCGGCGTGGTCCTGGCGGCGATGCAGGTCGCAGGC
ACTGTCAACCCTCTCAAGGACGATGAAACCTTTCAGCGAGCGGCATTTGGGTTCTCGGTATTCACCATGGTCGCC
ATGGTCTTCTTCTCGGGCGTTGCGTTGGGGTACTTTGTCGTCATGTTTACCTTGAATCTCATATTCACCAAGGCA
AGGGTGAAGGAGAAGGCGAGGTTAAAACAATGCCAGAGCACAGCGCCAACCTCGGACGCGCGAGAGTGTCGAGAG
GGAGAGAATCTTGTGTAG
Transcript >OphauB2|1463
ATGGCGACATCGACTGCGAAGCCTCCTTTTGGGAAACATGTCACGCCAATCATCAACGGAAATTTTCAAAGCCGA
TCCCAACCGACCACGCCTCGTCTGGCCAAGCCTCCAGTGCTACCATTTTATGACAGCATCACGCCAACTCTTTAC
CTCAAGCAAACAAGTCTCATTCCCATCCACACCGCCAAGGAATACCTCCAACAGTCGTTCGACCTGGAGCGCCTT
CACCGCGTGCAAAAGTGGCTGTGGCTGGCCGGCCTGCCCCTTCCAGCGCGGTCCCTCCACAGGCAAAAGATTCTG
GGTCGCGAGATTGTGATAACGGAGCAGGCCGACATGCATCTCACCTGGCGCGAATCCACGCTTTTCCTCAAGCCT
CTCTGGAAACCACTACTCGACTACGCCTTCTGGGAAGAAGCGCTCTGCCATGGCGACCCAGCGGTTTACCAAAGC
GCGGCCGGCCTTGTACTCTCTTACACCTGGCTCATTGCTTCAAAGCCAGACTTGCAGATTGCGAAGCAGCACAAG
CTGGTTCCCAAGAAGCTCAAGTGGGAGGTCTGGGCCGCGTTTGTCCGCGACTTTTTAAAGACGCACAACTTGCAC
AACTTTGATTCACTCGTCGCCGCACGCTACGACTATGGTGATTTGCGACTTAATCGTCTCAACCTCATCTACCGC
TTCGCCCCCGAGTTATTCCCCACGTATCTTATGCGAGGGTATTTCTACGGCTACAACAGGTATAGCCAATTCTTT
GGACGCAATTTTGCCTGGGCCGCCGTGGCCGTCTTGTATGTCGGCGTGGTCCTGGCGGCGATGCAGGTCGCAGGC
ACTGTCAACCCTCTCAAGGACGATGAAACCTTTCAGCGAGCGGCATTTGGGTTCTCGGTATTCACCATGGTCGCC
ATGGTCTTCTTCTCGGGCGTTGCGTTGGGGTACTTTGTCGTCATGTTTACCTTGAATCTCATATTCACCAAGGCA
AGGGTGAAGGAGAAGGCGAGGTTAAAACAATGCCAGAGCACAGCGCCAACCTCGGACGCGCGAGAGTGTCGAGAG
GGAGAGAATCTTGTGTAG
Gene >OphauB2|1463
ATGGCGACATCGACTGCGAAGCCTCCTTTTGGGAAACATGTCACGCCAATCATCAACGGAAATTTTCAAAGCCGA
TCCCAACCGACCACGCCTCGTCTGGCCAAGCCTCCAGTGCTACCATTTTATGACAGCATCACGCCAACTCTTTAC
CTCAAGCAAACAAGTCTCATTCCCATCCACACCGCCAAGGAATACCTCCAACAGTCGTTCGACCTGGAGCGCCTT
CACCGCGTGCAAAAGTGGCTGTGGCTGGCCGGCCTGCCCCTTCCAGCGCGGTCCCTCCACAGGCAAAAGATTCTG
GGTCGCGAGATTGTGATAACGGAGCAGGCCGACATGCATCTCACCTGGCGCGAATCCACGCTTTTCCTCAAGCCT
CTCTGGAAACCACTACTCGACTACGCCTTCTGGGAAGAAGCGCTCTGCCATGGCGACCCAGCGGTTTACCAAAGC
GCGGCCGGCCTTGTACTCTCTTACACCTGGCTCATTGCTTCAAAGCCAGACTTGCAGATTGCGAAGCAGCACAAG
CTGGTTCCCAAGAAGCTCAAGTGGGAGGTCTGGGCCGCGTTTGTCCGCGACTTTTTAAAGACGCACAACTTGCAC
AACTTTGATTCACTCGTCGCCGCACGCTACGACTATGGTGATTTGCGACTTAATCGTCTCAACCTCATCTACCGC
TTCGCCCCCGAGTTATTCCCCACGTATCTTATGCGAGGGTATTTCTACGGCTACAACAGGTATAGCCAATTCTTT
GGACGCAATTTTGCCTGGGCCGCCGTGGCCGTCTTGTATGTCGGCGTGGTCCTGGCGGCGATGCAGGTCGCAGGC
ACTGTCAACCCTCTCAAGGACGATGAAACCTTTCAGCGAGCGGCATTTGGGTTCTCGGTATTCACCATGGTCGCC
ATGGTCTTCTTCTCGGGCGTTGCGTTGGGGTACTTTGTCGTCATGTTTACCTTGAATCTCATATTCACCAAGGCA
AGGGTGAAGGAGAAGGCGAGGTTAAAACAATGCCAGAGCACAGCGCCAACCTCGGACGCGCGAGAGTGTCGAGAG
GGAGAGAATCTTGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail